Animal-Free 4-1BBL/TNFSF9 Protein, Human (His)

4-1BBL/TNFSF9 protein is a cytokine that selectively binds to TNFRSF9 and exerts its effects by inducing the proliferation of activated peripheral blood T cells. As a homotrimer, this ligand demonstrates its potential role in activation-induced cell death (AICD) and may be involved in coordinating homologous interactions between T cells and B cells/macrophages. Animal-Free 4-1BBL/TNFSF9 Protein, Human (His) is the recombinant human-derived animal-Free4-1BBL/TNFSF9 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free 4-1BBL/TNFSF9 Protein, Human (His) is 185 a.a., with molecular weight of ~20.38 kDa.

The 4-1BBL (TNFSF9) protein is a cytokine with significant immunomodulatory functions, binding to the TNFRSF9 receptor. Its interaction induces the proliferation of activated peripheral blood T-cells, suggesting a role in T-cell activation and immune response amplification. Additionally, 4-1BBL may be involved in activation-induced cell death (AICD), a process that regulates the survival and homeostasis of activated immune cells. Furthermore, the protein might play a role in mediating cognate interactions between T-cells and B-cells/macrophages, contributing to immune cell communication and coordination. Structurally, 4-1BBL forms homotrimers, indicating its organization into trimeric complexes. These diverse functions underscore the pivotal role of 4-1BBL in immune regulation and intercellular communication within the immune system.

4-1BB (human; 1 μg/mL; 16 h) leads to induction of monocyte activation and induces Myc protein production^[4].
4-1BB (human; 1 μg/mL; 1 d) prolongs survival of peripheral monocytes and (1 μg/mL; 1 h) induces expression of M-CSF^[5].
4-1BB (human; 1.2-4 μg/mL; 7 d) exhibits nhancement of cell numbers dose-dependently^[6].

Measure by its ability to induce IL-8 secretion in human PBMCs. The ED₅₀ for this effect is 1-5 ng/mL

Human

E. coli

C-His

P41273 (M70-E254)

8744  [NCBI]

MREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Approximately 20.38 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.