1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Neurotrophic Factors
  4. Neurotrophins/NGF
  5. Brain Derived Neurotrophic Factor (BDNF)
  6. Animal-Free BDNF Protein, Human/Mouse (His)

Animal-Free BDNF Protein, Human/Mouse (His)

Cat. No.: HY-P700158AF
Handling Instructions Technical Support

Brain Derived Neurotrophic Factor (BDNF) is a neurotrophin that belongs to NGF-beta family. BDNF can bind to its high affinity receptor TrkB and activates signal transduction cascades (IRS1/2, PI3K, Akt). BDNF can also bind to the p75NTR, but the affinity for the p75NTR receptor is lower than for TrkB. BDNF is a neurotransmitter modulator, and is vital in maturation, survival and differentiation of neuronal populations during development. BDNF also participates in neuronal plasticity, which is essential for learning and memory. BDNF is widely expressed in the CNS. Animal-Free BDNF Protein, Human/Mouse (His) is an animal-free recombinant human/muose BDNF (H129-R247) with C-terminal His tag, which is produced in E.coli.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Brain Derived Neurotrophic Factor (BDNF) is a neurotrophin that belongs to NGF-beta family. BDNF can bind to its high affinity receptor TrkB and activates signal transduction cascades (IRS1/2, PI3K, Akt)[1]. BDNF can also bind to the p75NTR, but the affinity for the p75NTR receptor is lower than for TrkB[2]. BDNF is a neurotransmitter modulator, and is vital in maturation, survival and differentiation of neuronal populations during development. BDNF also participates in neuronal plasticity, which is essential for learning and memory. BDNF is widely expressed in the CNS[1]. Animal-Free BDNF Protein, Human/Mouse (His) is an animal-free recombinant human/muose BDNF (H129-R247) with C-terminal His tag, which is produced in E.coli.This product is for cell culture use only.

Background

BDNF, a neurotrophin that belongs to NGF-beta family. BDNF is widely expressed in the CNS, gut and other tissues. BDNF regulates neurodevelopmental processes, including maturation, survival and differentiation of neuronal populations, and synaptic plasticity[1].
BDNF can bind to its high affinity receptor TrkB and activates signal transduction cascades (IRS1/2, PI3K, Akt), thereby inducing increased Ca2+ intake and phosphorylation of transcription factors. BDNF can also bind to the p75NTR, but the affinity for the p75NTR receptor is lower than for TrkB. The activation of p75NTR increases apoptotic and inflammatory signaling in neurons and glial cells by activation of c-Jun N-terminal kinases (JNK) and NF-κB expression, respectively[2]. In human, decreased levels of BDNF are associated with neurodegenerative diseases (such as Parkinson's disease and Alzheimer's disease) and type 2 diabetes mellitus[1]. Human BDNF shares >97% aa sequence identity with mouse and rat. Rat BDNF shares >99% aa sequence identity with mouse.
BDNF is a neurotransmitter modulator which is vital in maturation, survival and differentiation of neuronal populations during development. BDNF also participates in neuronal plasticity, which is essential for learning and memory[1].

In Vitro

BDNF (human, 50 ng/mL, 3 days) increases percentage of neurite-bearing cells in PC12 cells[3].

In Vivo

BDNF (human, 0.25 μg/side, intrahippocampal administration) increases ERK1/2 and CREB activation and facilitated LTM in rats[4].

Biological Activity

Measure by its ability to induce proliferation in BaF3 cells transfected with TrkB. The ED50 for this effect is <2 ng/mL

Species

Human; Mouse

Source

E. coli

Tag

C-His

Accession

P23560 (H129-R247)

Gene ID

627  [NCBI]

Molecular Construction
N-term
BDNF (H129-R247)
Accession # P23560
His
C-term
Synonyms
rain-derived neurotrophic factor; BDNF; Abrineurin; ProBDNF
AA Sequence

MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Molecular Weight

Approximately 14.45 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free BDNF Protein, Human/Mouse (His)
Cat. No.:
HY-P700158AF
Quantity:
MCE Japan Authorized Agent: