Animal-Free BMP-13/GDF-6 Protein, Human (His)

The BMP-13/GDF-6 protein is a key growth factor that regulates retinal protrusions, apoptosis, and dorsal-ventral positional information and is essential for the formation of the retinal tectum pattern. It is integral to the bones and joints of the limbs, skull, fingers and axial skeleton during skeletal development, shaping species-specific skeletal evolution. Animal-Free BMP-13/GDF-6 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-13/GDF-6 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free BMP-13/GDF-6 Protein, Human (His) is 120 a.a., with molecular weight of ~14.50 kDa.

Animal-Free BMP-13/GDF-6 Protein, a pivotal growth factor, governs crucial processes, including proliferation and cellular differentiation in the retina and bone formation. Its regulatory role in apoptosis during retinal development is essential, contributing to the establishment of dorsal-ventral positional information and controlling the formation of the retinotectal map. In the context of skeletal development, this growth factor is indispensable for the normal formation of bones and joints in diverse anatomical regions, such as limbs, skull, digits, and axial skeleton. Additionally, it plays a key role in delineating boundaries between skeletal elements, suggesting a role in species-specific skeletal evolution. Functionally, BMP-13/GDF-6 exhibits positive regulation of chondrogenic tissue differentiation through specific growth factor receptor subunits, including BMPR1A, BMPR1B, BMPR2, and ACVR2A, culminating in the activation of the SMAD1-SMAD5-SMAD8 complex. Notably, NOG serves as an inhibitor in the regulation of chondrogenic differentiation. Furthermore, BMP-13/GDF-6 is implicated in the induction of adipogenesis from mesenchymal stem cells, engaging growth factor receptors BMPR1A, BMPR2, and ACVR2A, and activating the SMAD1-SMAD5-SMAD8 complex and MAPK14/p38 through a mechanism of homodimerization with disulfide-linked structures.

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED₅₀ for this effect is 63-240 ng/mL.

Human

E. coli

C-His

Q6KF10 (T336-R455)

392255  [NCBI]

MTAFASRHGKRHGKKSRLRCSKKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR

Approximately 14.50 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.