1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. TGF-beta Superfamily
  4. Bone Morphogenetic Proteins (BMPs)
  5. BMP-4
  6. Animal-Free BMP-4 Protein, Pig (His)

Bone morphogenetic protein 4 (BMP-4) is a polymorphic ligand protein belonging to the TGF-β family, which is involved in the circulation of the vascular system and can activate receptors on vascular cells. BMP-4 binds to type I receptors (ALK-2/-3/-6) and type II receptors (BMPR2, ACVR2A) to increase plaque formation and promote oxidative stress, endothelial dysfunction, and osteogenic differentiation through its pro-inflammatory and pro-atherogenic effects. Animal-Free BMP-4 Protein, Pig (His) has a total length of 182 amino acids (R43-C224), is expressed in E. coli cells with C-terminal His-tag.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
20 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Bone morphogenetic protein 4 (BMP-4) is a polymorphic ligand protein belonging to the TGF-β family, which is involved in the circulation of the vascular system and can activate receptors on vascular cells[1]. BMP-4 binds to type I receptors (ALK-2/-3/-6) and type II receptors (BMPR2, ACVR2A)[2] to increase plaque formation and promote oxidative stress, endothelial dysfunction, and osteogenic differentiation through its pro-inflammatory and pro-atherogenic effects[3]. Animal-Free BMP-4 Protein, Pig (His) has a total length of 182 amino acids (R43-C224), is expressed in E. coli cells with C-terminal His-tag.This product is for cell culture use only.

Background

Bone Morphogenetic Protein 4 (BMP-4) is a ligand protein with pleiotropic, belongs to TGFβ family. BMP-4 involves in the vasculature circulation and can activate receptors on vascular cells[1].
BMP-4/TGFβ signaling can be terminated by inhibitory SMADs including SMAD6 and SMAD7, which are activated and induced by BMP signaling and switch off BMP signaling via multiple mechanisms[4].
BMP-4 is widely found in different animals, while the sequence in human is highly similar to Rat (96.81%), and mouse (97.54%).
BMP-4 is expressed by endothelial cells (ECs) in response to hypoxia and promotes vascular SMC proliferation. Therefore it inhibits the proliferation of smooth muscle cells (SMCs) isolated from the proximal pulmonary artery while induces proliferation of SMCs isolated from distal pulmonary arteries[5].
BMP-4 appears to be a marker and driver of vascular calcification, particularly in atherosclerosis[6].
BMP-4 induces angiogenesis, endothelial cells (ECs) proliferation, and migration[7].
BMP-4 is differentially expressed in calcified atherosclerotic plaques[8], serves as the linkers between atherosclerotic vascular calcification with mechanisms of normal bone formation[9].
BMP-4 increases plaque formation via their pro-inflammatory and pro-atherogenic effects, promoting oxidative stress, endothelial dysfunction and osteogenic differentiation[3].

Species

Pig

Source

E. coli

Tag

C-His

Accession

A7LJT9 (R237-C408)

Gene ID

100113425

Molecular Construction
N-term
BMP-4 (R237-C408)
Accession # A7LJT9
His
C-term
Synonyms
BMP-2B; BMP-4; Bone morphogenetic protein 4; DVR4
AA Sequence

MREKQPNYGLAIEVTHLHQTRTHQGQHVRISRSLPQGSGDWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHPQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGC

Molecular Weight

Approximately 21.65 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl pH 3.5, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free BMP-4 Protein, Pig (His)
Cat. No.:
HY-P700230AF
Quantity:
MCE Japan Authorized Agent: