Animal-Free BMP-5 Protein, Human (His)

BMP-5 protein is an important member of the TGF-β superfamily and is essential for cartilage and bone formation as well as neurogenesis. It activates canonical BMP signaling through BMPR1A and BMPR2 and phosphorylates SMAD1/5/8 for gene transcription regulation. Animal-Free BMP-5 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-5 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free BMP-5 Protein, Human (His) is 138 a.a., with molecular weight of ~16.57 kDa.

BMP-5 Protein, a crucial member of the TGF-beta superfamily, plays indispensable roles in various developmental processes, including cartilage and bone formation, as well as neurogenesis. It triggers the canonical BMP signaling cascade by binding to type I receptor BMPR1A and type II receptor BMPR2, leading to the phosphorylation of SMAD1/5/8, which modulate gene transcription. Additionally, BMP-5 can engage non-canonical pathways, such as the MAPK p38 signaling cascade, promoting chondrogenic differentiation. Notably, it promotes the expression of HAMP, a process regulated by its interaction with ERFE, which inhibits BMP-induced transcription of HAMP. The intricate signaling network involving BMP-5 underscores its versatile regulatory functions in diverse cellular processes.

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells.The ED₅₀ for this effect is <0.17 μg/mL.

Human

E. coli

C-His

P22003 (A317-H454)

653  [NCBI]

MAANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH

Approximately 16.57 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.