1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. TGF-beta Superfamily
  4. Bone Morphogenetic Proteins (BMPs)
  5. Bone Morphogenetic Protein 5
  6. Animal-Free BMP-5 Protein, Human (His)

BMP-5 protein is an important member of the TGF-β superfamily and is essential for cartilage and bone formation as well as neurogenesis. It activates canonical BMP signaling through BMPR1A and BMPR2 and phosphorylates SMAD1/5/8 for gene transcription regulation. Animal-Free BMP-5 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-5 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free BMP-5 Protein, Human (His) is 138 a.a., with molecular weight of ~16.57 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BMP-5 protein is an important member of the TGF-β superfamily and is essential for cartilage and bone formation as well as neurogenesis. It activates canonical BMP signaling through BMPR1A and BMPR2 and phosphorylates SMAD1/5/8 for gene transcription regulation. Animal-Free BMP-5 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-5 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free BMP-5 Protein, Human (His) is 138 a.a., with molecular weight of ~16.57 kDa.

Background

BMP-5 Protein, a crucial member of the TGF-beta superfamily, plays indispensable roles in various developmental processes, including cartilage and bone formation, as well as neurogenesis. It triggers the canonical BMP signaling cascade by binding to type I receptor BMPR1A and type II receptor BMPR2, leading to the phosphorylation of SMAD1/5/8, which modulate gene transcription. Additionally, BMP-5 can engage non-canonical pathways, such as the MAPK p38 signaling cascade, promoting chondrogenic differentiation. Notably, it promotes the expression of HAMP, a process regulated by its interaction with ERFE, which inhibits BMP-induced transcription of HAMP. The intricate signaling network involving BMP-5 underscores its versatile regulatory functions in diverse cellular processes.

Biological Activity

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells.The ED50 for this effect is <0.17 μg/mL.

Species

Human

Source

E. coli

Tag

C-His

Accession

P22003 (A317-H454)

Gene ID

653  [NCBI]

Molecular Construction
N-term
BMP-5 (A317-H454)
Accession # P22003
His
C-term
Synonyms
Bone morphogenetic protein 5; BMP5
AA Sequence

MAANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH

Molecular Weight

Approximately 16.57 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free BMP-5 Protein, Human (His)
Cat. No.:
HY-P700028AF
Quantity:
MCE Japan Authorized Agent: