1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. TGF-beta Superfamily
  4. Bone Morphogenetic Proteins (BMPs)
  5. Bone Morphogenetic Protein 5
  6. Animal-Free BMP-5 Protein, Human (His)

BMP-5 protein is an important member of the TGF-β superfamily and is essential for cartilage and bone formation as well as neurogenesis. It activates canonical BMP signaling through BMPR1A and BMPR2 and phosphorylates SMAD1/5/8 for gene transcription regulation. Animal-Free BMP-5 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-5 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BMP-5 protein is an important member of the TGF-β superfamily and is essential for cartilage and bone formation as well as neurogenesis. It activates canonical BMP signaling through BMPR1A and BMPR2 and phosphorylates SMAD1/5/8 for gene transcription regulation. Animal-Free BMP-5 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-5 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

BMP-5 Protein, a crucial member of the TGF-beta superfamily, plays indispensable roles in various developmental processes, including cartilage and bone formation, as well as neurogenesis. It triggers the canonical BMP signaling cascade by binding to type I receptor BMPR1A and type II receptor BMPR2, leading to the phosphorylation of SMAD1/5/8, which modulate gene transcription. Additionally, BMP-5 can engage non-canonical pathways, such as the MAPK p38 signaling cascade, promoting chondrogenic differentiation. Notably, it promotes the expression of HAMP, a process regulated by its interaction with ERFE, which inhibits BMP-induced transcription of HAMP. The intricate signaling network involving BMP-5 underscores its versatile regulatory functions in diverse cellular processes.

Biological Activity

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells.The ED50 for this effect is <0.17 μg/mL.

Species

Human

Source

E. coli

Tag

C-His

Accession

P22003 (A317-H454)

Gene ID

653  [NCBI]

Molecular Construction
N-term
BMP-5 (A317-H454)
Accession # P22003
His
C-term
Synonyms
Bone morphogenetic protein 5; BMP5
AA Sequence

MAANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH

Molecular Weight

Approximately 16.57 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free BMP-5 Protein, Human (His)
Cat. No.:
HY-P700028AF
Quantity:
MCE Japan Authorized Agent: