Animal-Free BMP-6 Protein, Human (His)

BMP-6 protein is a member of the TGF-β superfamily and is critical in various developmental processes including skeletal development. It acts as a key regulator of HAMP/hepcidin expression and iron metabolism via hemojuvelin/HJV. Animal-Free BMP-6 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-6 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free BMP-6 Protein, Human (His) is 117 a.a., with molecular weight of ~14.07 kDa.

BMP-6 Protein, a member of the TGF-beta superfamily, is indispensable in various developmental processes, including cartilage and bone formation. Beyond its roles in skeletal development, BMP-6 serves as a crucial regulator of HAMP/hepcidin expression and iron metabolism by acting as a ligand for hemojuvelin/HJV. Moreover, it can promote HAMP expression, potentially through interaction with its receptor BMPR1A/ALK3. The initiation of the canonical BMP signaling cascade involves BMP-6 associating with the type I receptor ACVR1 and type II receptor ACVR2B, with ACVR1 propagating signals by phosphorylating SMAD1/5/8 that travel to the nucleus and act as activators and repressors of transcription of target genes. Additionally, BMP-6 can engage non-canonical pathways, such as the TAZ-Hippo signaling cascade, influencing VEGF signaling by regulating VEGFR2 expression. It forms interactions with various proteins, including SOSTDC1, Hemojuvelin/HJV, ERFE, and BMPR1A/ALK3, showcasing its versatile regulatory roles in different cellular processes.

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED₅₀ for this effect is <87 ng/mL

Human

E. coli

C-His

P22004 (V397-H513)

654  [NCBI]

MVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH

Approximately 14.07 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5 or PBS, pH 8.0.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.