1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. TGF-beta Superfamily
  4. Bone Morphogenetic Proteins (BMPs)
  5. BMP-6
  6. Animal-Free BMP-6 Protein, Human (His)

Animal-Free BMP-6 Protein, Human (His)

Cat. No.: HY-P700029AF
SDS COA Handling Instructions

BMP-6 protein is a member of the TGF-β superfamily and is critical in various developmental processes including skeletal development. It acts as a key regulator of HAMP/hepcidin expression and iron metabolism via hemojuvelin/HJV. Animal-Free BMP-6 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-6 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free BMP-6 Protein, Human (His) is 117 a.a., with molecular weight of ~14.07 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $106 In-stock
10 μg $298 In-stock
50 μg $835 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BMP-6 protein is a member of the TGF-β superfamily and is critical in various developmental processes including skeletal development. It acts as a key regulator of HAMP/hepcidin expression and iron metabolism via hemojuvelin/HJV. Animal-Free BMP-6 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-6 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free BMP-6 Protein, Human (His) is 117 a.a., with molecular weight of ~14.07 kDa.

Background

BMP-6 Protein, a member of the TGF-beta superfamily, is indispensable in various developmental processes, including cartilage and bone formation. Beyond its roles in skeletal development, BMP-6 serves as a crucial regulator of HAMP/hepcidin expression and iron metabolism by acting as a ligand for hemojuvelin/HJV. Moreover, it can promote HAMP expression, potentially through interaction with its receptor BMPR1A/ALK3. The initiation of the canonical BMP signaling cascade involves BMP-6 associating with the type I receptor ACVR1 and type II receptor ACVR2B, with ACVR1 propagating signals by phosphorylating SMAD1/5/8 that travel to the nucleus and act as activators and repressors of transcription of target genes. Additionally, BMP-6 can engage non-canonical pathways, such as the TAZ-Hippo signaling cascade, influencing VEGF signaling by regulating VEGFR2 expression. It forms interactions with various proteins, including SOSTDC1, Hemojuvelin/HJV, ERFE, and BMPR1A/ALK3, showcasing its versatile regulatory roles in different cellular processes.

Biological Activity

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <87 ng/mL

Species

Human

Source

E. coli

Tag

C-His

Accession

P22004 (V397-H513)

Gene ID

654  [NCBI]

Molecular Construction
N-term
BMP-6 (V397-H513)
Accession # P22004
His
C-term
Synonyms
Bone morphogenetic protein 6; Bmp6; BMP-6; VG-1-related protein; VGR-1; Vgr1
AA Sequence

MVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH

Molecular Weight

Approximately 14.07 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5 or PBS, pH 8.0.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free BMP-6 Protein, Human (His)
Cat. No.:
HY-P700029AF
Quantity:
MCE Japan Authorized Agent: