1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. GRO-gamma
  6. Animal-Free DCIP-1/CXCL3 Protein, Mouse (His)

Animal-Free DCIP-1/CXCL3 Protein, Mouse (His)

Cat. No.: HY-P700172AF
Handling Instructions Technical Support

DCIP-1/CXCL3 Protein, a CXCR2 ligand, exhibits chemotactic activity for neutrophils, implicating its role in inflammation. It may autonomously affect endothelial cells. The protein's chemotactic activity implies a potential regulatory role in recruiting and activating neutrophils in response to inflammatory stimuli. Animal-Free DCIP-1/CXCL3 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeDCIP-1/CXCL3 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free DCIP-1/CXCL3 Protein, Mouse (His) is 73 a.a., with molecular weight of ~8.72 kDa.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

DCIP-1/CXCL3 Protein, a CXCR2 ligand, exhibits chemotactic activity for neutrophils, implicating its role in inflammation. It may autonomously affect endothelial cells. The protein's chemotactic activity implies a potential regulatory role in recruiting and activating neutrophils in response to inflammatory stimuli. Animal-Free DCIP-1/CXCL3 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeDCIP-1/CXCL3 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free DCIP-1/CXCL3 Protein, Mouse (His) is 73 a.a., with molecular weight of ~8.72 kDa.This product is for cell culture use only.

Background

The DCIP-1/CXCL3 protein functions as a ligand for CXCR2, displaying chemotactic activity for neutrophils. This protein is implicated in inflammation and may exert its effects on endothelial cells in an autocrine fashion. The chemotactic activity of DCIP-1/CXCL3 for neutrophils suggests its potential role in regulating the recruitment and activation of these immune cells in response to inflammatory stimuli.

Biological Activity

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <80 ng/mL

Species

Mouse

Source

E. coli

Tag

N-His

Accession

Q6W5C0 (A28-S100)

Gene ID
Molecular Construction
N-term
His
CXCL3 (A28-S100)
Accession # Q6W5C0
C-term
Synonyms
rMuDCIP-1/CXCL3; C-X-C motif chemokine 3; Dendritic cell inflammatory protein 1
AA Sequence

AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS

Molecular Weight

Approximately 8.72 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Animal-Free DCIP-1/CXCL3 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free DCIP-1/CXCL3 Protein, Mouse (His)
Cat. No.:
HY-P700172AF
Quantity:
MCE Japan Authorized Agent: