1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. EGF Superfamily
  4. EGF
  5. Animal-Free EGF Protein, Human (His)

Animal-Free EGF Protein, Human (His)

Cat. No.: HY-P700051AF
COA Handling Instructions

EGF protein does not possess the conserved residue(s) necessary for propagating feature annotation. Animal-Free EGF Protein, Human (His) is the recombinant human-derived animal-FreeEGF protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free EGF Protein, Human (His) is 53 a.a., with molecular weight of ~7.16 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg $28 In-stock
10 μg $45 In-stock
50 μg $73 In-stock
100 μg $95 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

EGF protein does not possess the conserved residue(s) necessary for propagating feature annotation. Animal-Free EGF Protein, Human (His) is the recombinant human-derived animal-FreeEGF protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free EGF Protein, Human (His) is 53 a.a., with molecular weight of ~7.16 kDa.

Background

EGF Protein lacks conserved residue(s) required for the propagation of feature annotation.

Biological Activity

The ED50 is <1 ng/mL as measure by its ability to induce 3T3 cells proliferation, corresponding to a specific activity of approximately >1 × 106 IU/mg.

Species

Human

Source

E. coli

Tag

C-His

Accession

A0A494C018 (N848-R900)

Gene ID
Molecular Construction
N-term
EGF (N848-R900)
Accession # A0A494C018
His
C-term
Synonyms
Urogastrone; URG
AA Sequence

MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Molecular Weight

Approximately 7.16 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free EGF Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free EGF Protein, Human (His)
Cat. No.:
HY-P700051AF
Quantity:
MCE Japan Authorized Agent: