Animal-Free EGF Protein, Human (His)

EGF protein does not possess the conserved residue(s) necessary for propagating feature annotation. Animal-Free EGF Protein, Human (His) is the recombinant human-derived animal-FreeEGF protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free EGF Protein, Human (His) is 53 a.a., with molecular weight of ~7.16 kDa.

EGF Protein lacks conserved residue(s) required for the propagation of feature annotation.

The ED₅₀ is <1 ng/mL as measure by its ability to induce 3T3 cells proliferation, corresponding to a specific activity of approximately >1 × 10⁶ IU/mg.

Human

E. coli

C-His

A0A494C018 (N848-R900)

1950  [NCBI]

MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Approximately 7.16 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a solution containing 1X PBS, pH 8.0.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.