Animal-Free ENA-78/CXCL5 Protein, Human (His)

The CXCL5 protein is critical in neutrophil activation and displays enhanced chemotactic activity on neutrophils, with increased potency of ENA-78(8-78) and ENA-78(9-78) isoforms three times. Structurally, CXCL5 exists as monomers and homodimers, emphasizing its multifunctional molecular configuration. Animal-Free ENA-78/CXCL5 Protein, Human (His) is the recombinant human-derived animal-FreeENA-78/CXCL5 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free ENA-78/CXCL5 Protein, Human (His) is 70 a.a., with molecular weight of ~8.51 kDa.

The CXCL5 protein plays a pivotal role in neutrophil activation, exhibiting heightened chemotactic activity for neutrophil granulocytes in vitro, particularly with its ENA-78(8-78) and ENA-78(9-78) isoforms displaying a threefold increase in chemotactic potency. Structurally, CXCL5 exists both as a monomer and a homodimer, emphasizing its versatility in molecular configurations. This dual nature suggests its capacity to engage in distinct interactions and functional activities related to neutrophil activation, highlighting CXCL5's crucial role in immune response modulation.

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED₅₀ for this effect is <10 ng/mL.

Human

E. coli

N-His

P42830 (R45-N114)

6374  [NCBI]

RELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

Approximately 8.51 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.