Animal-Free EpCAM/TROP1 Protein, Human (His)

The EpCAM/TROP1 protein serves as an important homogeneous interacting molecule that promotes direct contact between intestinal epithelial cells (IEC) and intraepithelial lymphocytes (IEL) in the mucosal epithelium. This feature helps establish an immune barrier against mucosal infections. Animal-Free EpCAM/TROP1 Protein, Human (His) is the recombinant human-derived animal-FreeEpCAM/TROP1 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free EpCAM/TROP1 Protein, Human (His) is 242 a.a., with molecular weight of ~28.36 kDa.

The EpCAM/TROP1 Protein emerges as a pivotal entity, potentially functioning as a physical homophilic interaction molecule that fosters direct contact between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium, thereby contributing to the establishment of an immunological barrier as the primary defense against mucosal infections. Beyond its role in mucosal immunity, this protein plays a significant part in the proliferation and differentiation of embryonic stem cells. It further exhibits regulatory influence by up-regulating the expression of FABP5, MYC, and cyclins A and E, implicating EpCAM/TROP1 in the modulation of key cellular processes. Its monomeric nature and interaction with phosphorylated CLDN7 underscore the intricate molecular interactions involved, providing insights into the diverse functions of this protein in cellular physiology.

Measure by the ability of the immobilized protein to support the adhesion of the 3T3 cells. The ED₅₀ for this effect is 0.2-1.7 ng/mL.

Human

E. coli

C-His

P16422 (Q24-K265)

4072  [NCBI]

MQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

Approximately 28.36 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.