Animal-Free Fas Ligand Protein, Mouse (His)

The cytoplasmic form of Fas ligand protein exerts powerful effects by inhibiting gene transcription. This protein plays a crucial role in regulating cellular processes by inhibiting the expression of specific genes. Animal-Free Fas Ligand Protein, Mouse (His) is the recombinant mouse-derived animal-FreeFas Ligand protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free Fas Ligand Protein, Mouse (His) is 152 a.a., with molecular weight of ~18.14 kDa.

Fas Ligand Protein, in its cytoplasmic form, exerts a powerful impact by inhibiting gene transcription. This protein plays a crucial role in regulating cellular processes by suppressing the expression of specific genes. By preventing gene transcription, Fas Ligand Protein can modulate various biological pathways and influence cellular behavior. Understanding the mechanisms by which this protein functions can provide insights into gene regulation and potentially lead to the development of innovative approaches for controlling gene expression in various biological systems.

Measure by its ability to induce apoptosis in Jurkat cells. The ED₅₀ for this effect is <1 μg /mL.

Mouse

E. coli

N-His

Q544E9 (Q128-L279)

14103  [NCBI]

QIANPSTPSEKKEPRSVAHLTGNPHSRSIPLEWEDTYGTALISGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNQPLNHKVYMRNSKYPEDLVLMEEKRLNYCTTGQIWAHSSYLGAVFNLTSADHLYVNISQLSLINFEESKTFFGLYKL

Approximately 18.14 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 8.0.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.