Animal-Free FGF-17 Protein, Human (His)

FGF-17 Protein plays a crucial role in embryonic development, serving as a signaling molecule for brain induction and patterning. Its presence is vital for normal brain development, emphasizing its significance in shaping embryogenesis intricacies. FGF-17 interacts with FGFR3 and FGFR4, underscoring its involvement in signaling cascades that precisely orchestrate developmental events in the embryonic brain. Animal-Free FGF-17 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-17 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free FGF-17 Protein, Human (His) is 194 a.a., with molecular weight of ~23.32 kDa.

FGF-17 Protein assumes a crucial role in regulating embryonic development and serves as a signaling molecule in the induction and patterning of the embryonic brain. Its presence is essential for normal brain development, emphasizing its significance in shaping the intricate processes of embryogenesis. Notably, FGF-17 interacts with FGFR3 and FGFR4, underscoring its involvement in intricate signaling cascades that contribute to the precise orchestration of developmental events in the embryonic brain.

Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is <5 ng/mL. The specific activity of recombinant human FGF-17 is > 2 x 10⁵ IU/mg.

Human

E. coli

N-His

O60258 (T23-T216)

8822  [NCBI]

TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Approximately 23.32 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.