1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-18
  6. Animal-Free FGF-18 Protein, Human (His)

Animal-Free FGF-18 Protein, Human (His)

Cat. No.: HY-P700061AF
COA Handling Instructions

FGF-18 Protein intricately regulates cell proliferation, differentiation, and migration, crucial in normal ossification and bone development for skeletal maturation. It stimulates hepatic and intestinal proliferation, showcasing versatile functions. Interactions with FGFR3 and FGFR4 underscore FGF-18 Protein's significance in modulating intricate signaling pathways for fundamental tissue development and homeostasis. Animal-Free FGF-18 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-18 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free FGF-18 Protein, Human (His) is 173 a.a., with molecular weight of ~21.11 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg $50 In-stock
10 μg $135 In-stock
50 μg $350 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FGF-18 Protein intricately regulates cell proliferation, differentiation, and migration, crucial in normal ossification and bone development for skeletal maturation. It stimulates hepatic and intestinal proliferation, showcasing versatile functions. Interactions with FGFR3 and FGFR4 underscore FGF-18 Protein's significance in modulating intricate signaling pathways for fundamental tissue development and homeostasis. Animal-Free FGF-18 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-18 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free FGF-18 Protein, Human (His) is 173 a.a., with molecular weight of ~21.11 kDa.

Background

FGF-18 Protein assumes a pivotal role in intricately regulating cell proliferation, differentiation, and migration. Its indispensability extends to the orchestration of normal ossification and bone development, emphasizing its crucial involvement in skeletal maturation. Additionally, FGF-18 Protein demonstrates the ability to stimulate hepatic and intestinal proliferation, highlighting its versatile functions across different tissues. The mediation of these cellular processes is facilitated through interactions with FGFR3 and FGFR4, underscoring the significance of FGF-18 Protein in modulating intricate signaling pathways that contribute to fundamental processes in tissue development and homeostasis.

Biological Activity

Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is 1.3-2.0 ng/mL. The specific activity of recombinant human FGF-18 is > 5 x 105 IU/mg.

Species

Human

Source

E. coli

Tag

C-His

Accession

O76093 (A27-R199)

Gene ID
Molecular Construction
N-term
FGF-18 (A27-R199)
Accession # O76093
His
C-term
Synonyms
FGF-18; zFGF5; FGF18
AA Sequence

MAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSR

Molecular Weight

Approximately 21.11 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free FGF-18 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free FGF-18 Protein, Human (His)
Cat. No.:
HY-P700061AF
Quantity:
MCE Japan Authorized Agent: