Animal-Free FGF-19 Protein, Human (His)

FGF-19 protein plays a crucial role in regulating bile acid biosynthesis by inhibiting CYP7A1 expression through positive regulation of JNK and ERK1/2 cascades. It stimulates glucose uptake in adipocytes, dependent on KLB and FGFR4. Animal-Free FGF-19 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-19 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free FGF-19 Protein, Human (His) is 194 a.a., with molecular weight of ~22.62 kDa.

The FGF-19 Protein plays a pivotal role in the regulation of bile acid biosynthesis by suppressing CYP7A1 expression through the positive modulation of the JNK and ERK1/2 cascades. Additionally, FGF-19 stimulates glucose uptake in adipocytes, and its activity is contingent upon the presence of both KLB and FGFR4. The protein forms crucial interactions with FGFR1, FGFR2, FGFR3, and FGFR4, emphasizing its involvement in FGF receptor signaling pathways. The affinity between FGFs and their receptors is augmented by KL, KLB, and heparan sulfate glycosaminoglycans, acting as coreceptors. FGF-19 directly interacts with KL and KLB, and in the presence of heparin, KL, or KLB, it forms an interaction with FGFR4. Additionally, FGF-19 interacts with MALRD1, highlighting its diverse molecular associations and suggesting its involvement in intricate cellular processes.

Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is <51 ng/mL.

Human

E. coli

C-His

O95750 (R23-K216)

9965  [NCBI]

MRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Approximately 22.62 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.