1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-22
  6. Animal-Free FGF-22 Protein, Human (His)

Animal-Free FGF-22 Protein, Human (His)

Cat. No.: HY-P700063AF
COA Handling Instructions

FGF-22 Protein, multifaceted in physiological processes, influences fasting response, glucose homeostasis, lipolysis, and lipogenesis. It stimulates in vitro cell proliferation and may contribute to hair development. Functionally, FGF-22 forms complexes with FGFR1 and FGFR2, integral to FGF signaling pathways. Interactions with FGFBP1 highlight its role in finely tuned regulatory networks governing cellular and metabolic activities. Animal-Free FGF-22 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-22 protein, expressed by E. coli , with N-SUMO, N-His labeled tag. The total length of Animal-Free FGF-22 Protein, Human (His) is 148 a.a., with molecular weight of ~29.35 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $65 In-stock
10 μg $180 In-stock
50 μg $500 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FGF-22 Protein, multifaceted in physiological processes, influences fasting response, glucose homeostasis, lipolysis, and lipogenesis. It stimulates in vitro cell proliferation and may contribute to hair development. Functionally, FGF-22 forms complexes with FGFR1 and FGFR2, integral to FGF signaling pathways. Interactions with FGFBP1 highlight its role in finely tuned regulatory networks governing cellular and metabolic activities. Animal-Free FGF-22 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-22 protein, expressed by E. coli , with N-SUMO, N-His labeled tag. The total length of Animal-Free FGF-22 Protein, Human (His) is 148 a.a., with molecular weight of ~29.35 kDa.

Background

FGF-22, a multifaceted protein, is intricately involved in diverse physiological processes, including the fasting response, glucose homeostasis, lipolysis, and lipogenesis. Beyond its metabolic roles, FGF-22 exhibits the capacity to stimulate cell proliferation in vitro, highlighting its impact on cellular dynamics. Moreover, the protein may contribute to the intricate processes underlying hair development. Functionally, FGF-22 engages in significant molecular interactions, forming complexes with FGFR1 and FGFR2, essential players in FGF signaling pathways. Additionally, it interacts with FGFBP1, further emphasizing its involvement in finely tuned regulatory networks that govern various cellular and metabolic activities.

Biological Activity

The ED50 is <2 ng/mL as measure by its ability to induce 3T3 cells proliferation.

Species

Human

Source

E. coli

Tag

N-SUMO

Accession

Q9HCT0 (T23-S170)

Gene ID
Molecular Construction
N-term
SUMO
FGF-22 (T23-S170)
Accession # Q9HCT0
C-term
Synonyms
Fibroblast growth factor 22; FGF22; FGF-22
AA Sequence

TPSASRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGRVQGTRWRHGQDSILEIRSVHVGVVVIKAVSSGFYVAMNRRGRLYGSRLYTVDCRFRERIEENGHNTYASQRWRRRGQPMFLALDRRGGPRPGGRTRRYHLSAHFLPVLVS

Molecular Weight

Approximately 29.35 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 10 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free FGF-22 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free FGF-22 Protein, Human (His)
Cat. No.:
HY-P700063AF
Quantity:
MCE Japan Authorized Agent: