Animal-Free FGF-23 Protein, Human (His)

FGF-23 protein is an important regulator of phosphate homeostasis and inhibits renal tubular phosphate transport by reducing SLC34A1 levels. It upregulates EGR1 expression through KL, directly reduces PTH secretion, and negatively regulates osteoblast differentiation and matrix mineralization. Animal-Free FGF-23 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-23 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free FGF-23 Protein, Human (His) is 227 a.a., with molecular weight of ~26.27 kDa.

FGF-23 protein functions as a crucial regulator of phosphate homeostasis, as evidenced by its ability to inhibit renal tubular phosphate transport through the reduction of SLC34A1 levels. Additionally, it plays a role in up-regulating EGR1 expression in the presence of KL and acts directly on the parathyroid to decrease PTH secretion. This protein is involved in the regulation of vitamin-D metabolism and acts as a negative regulator of osteoblast differentiation and matrix mineralization. The interaction of FGF-23 with FGFR1, FGFR2, FGFR3, and FGFR4 further underscores its significance in cellular processes. Furthermore, the affinity between fibroblast growth factors (FGFs) and their receptors is enhanced by KL and heparan sulfate glycosaminoglycans, serving as crucial coreceptors in this regulatory network.

Measure by its ability to induce proliferation in BaF3 cells transfected with human FGFRIIIc. The ED₅₀ for this effect is <0.3 μg/mL.

Human

E. coli

C-His

Q9GZV9 (Y25-F251)

8074  [NCBI]

MYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI

Approximately 26.27 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.