1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-3
  6. Animal-Free FGF-3 Protein, Human (His)

Animal-Free FGF-3 Protein, Human (His)

Cat. No.: HY-P700065AF
COA Handling Instructions

FGF-3 Protein orchestrates embryonic development, cell proliferation, and differentiation, crucial for normal ear development and tissue morphogenesis. Interactions with FGFR1 and FGFR2, along with heparan sulfate glycosaminoglycans, underpin FGF-3's diverse functions. The potentiated binding affinity emphasizes the multifaceted nature of FGF-3 in shaping essential developmental processes through intricate molecular interactions. Animal-Free FGF-3 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-3 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free FGF-3 Protein, Human (His) is 185 a.a., with molecular weight of ~21.99 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
2 μg $35 In-stock
10 μg $90 In-stock
50 μg $235 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FGF-3 Protein orchestrates embryonic development, cell proliferation, and differentiation, crucial for normal ear development and tissue morphogenesis. Interactions with FGFR1 and FGFR2, along with heparan sulfate glycosaminoglycans, underpin FGF-3's diverse functions. The potentiated binding affinity emphasizes the multifaceted nature of FGF-3 in shaping essential developmental processes through intricate molecular interactions. Animal-Free FGF-3 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-3 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free FGF-3 Protein, Human (His) is 185 a.a., with molecular weight of ~21.99 kDa.

Background

FGF-3 Protein assumes a crucial role in orchestrating embryonic development, cell proliferation, and cell differentiation. Its significance is underscored by its necessity for normal ear development, reflecting its specific impact on tissue morphogenesis. FGF-3 engages in interactions with FGFR1 and FGFR2, forming molecular partnerships that underpin its diverse functions. The binding affinity between FGF-3 and its receptors is potentiated by heparan sulfate glycosaminoglycans, acting as essential coreceptors in this regulatory interplay. These intricate molecular interactions highlight the multifaceted nature of FGF-3 in shaping essential processes during development.

Biological Activity

Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <78 ng/mL.

Species

Human

Source

E. coli

Tag

C-His

Accession

P11487 (D28-R212)

Gene ID
Molecular Construction
N-term
FGF-3 (D28-R212)
Accession # P11487
His
C-term
Synonyms
HBGF-3; FGF3; Proto-oncogene Int-2; Heparin-binding growth factor 3; INT2; Fibroblast Growth Factor 3
AA Sequence

MDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHPSGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRR

Molecular Weight

Approximately 21.99 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free FGF-3 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free FGF-3 Protein, Human (His)
Cat. No.:
HY-P700065AF
Quantity:
MCE Japan Authorized Agent: