Animal-Free FGF-3 Protein, Human (His)

FGF-3 Protein orchestrates embryonic development, cell proliferation, and differentiation, crucial for normal ear development and tissue morphogenesis. Interactions with FGFR1 and FGFR2, along with heparan sulfate glycosaminoglycans, underpin FGF-3's diverse functions. The potentiated binding affinity emphasizes the multifaceted nature of FGF-3 in shaping essential developmental processes through intricate molecular interactions. Animal-Free FGF-3 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-3 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free FGF-3 Protein, Human (His) is 185 a.a., with molecular weight of ~21.99 kDa.

FGF-3 Protein assumes a crucial role in orchestrating embryonic development, cell proliferation, and cell differentiation. Its significance is underscored by its necessity for normal ear development, reflecting its specific impact on tissue morphogenesis. FGF-3 engages in interactions with FGFR1 and FGFR2, forming molecular partnerships that underpin its diverse functions. The binding affinity between FGF-3 and its receptors is potentiated by heparan sulfate glycosaminoglycans, acting as essential coreceptors in this regulatory interplay. These intricate molecular interactions highlight the multifaceted nature of FGF-3 in shaping essential processes during development.

Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is <78 ng/mL.

Human

E. coli

C-His

P11487 (D28-R212)

2248  [NCBI]

MDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHPSGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRR

Approximately 21.99 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.