Animal-Free FGF-4 Protein, Human (His)

The FGF-4 protein coordinates embryonic development, cell proliferation and differentiation and is critical for normal limb and heart valve development. FGF-4 may promote embryonic molar tooth bud development by inducing key gene expression. Animal-Free FGF-4 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-4 protein, expressed by E. coli , with C-His labeled tag.

FGF-4 Protein assumes a pivotal role in orchestrating embryonic development, cell proliferation, and cell differentiation. Its indispensability is evident in the normal development of limbs and cardiac valves during embryogenesis. Additionally, FGF-4 may contribute to embryonic molar tooth bud development by inducing the expression of key genes, including MSX1, MSX2, and SDC1, in dental mesenchyme cells, thus highlighting its diverse regulatory functions. FGF-4 engages in intricate interactions with FGFR1, FGFR2, FGFR3, and FGFR4, forming molecular alliances critical for signaling cascades. The binding affinity between FGF-4 and its receptors is potentiated by heparan sulfate glycosaminoglycans, serving as indispensable coreceptors in this complex regulatory network. These interactions underscore the multifaceted and essential role of FGF-4 in driving fundamental processes during development.

Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is <2.5 ng/mL. The specific activity of recombinant human FGF-4 is >4 x 10⁵ IU/mg.

Human

E. coli

C-His

P08620-1 (G25-L206)

2249  [NCBI]

MGRGGAAAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Approximately 20.70 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 0.1% sarkosyl in 1X PBS, pH 8.0, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.