Animal-Free FLT3LG Protein, Human (His)

FLT3LG Proteinas, a potent stimulator of early hematopoietic cell proliferation, activates FLT3 and synergizes with colony-stimulating factors and interleukins. As a homodimer, especially in isoform 2, it crucially promotes expansion and differentiation of hematopoietic progenitor cells. FLT3LG's collaborative signaling with other molecules underscores its significance in regulating hematopoiesis and maintaining hematopoietic system balance. Animal-Free FLT3LG Protein, Human (His) is the recombinant human-derived animal-FreeFLT3LG protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free FLT3LG Protein, Human (His) is 155 a.a., with molecular weight of ~18.6 kDa.

FLT3LG protein serves as a potent stimulator of early hematopoietic cell proliferation through the activation of FLT3, demonstrating synergistic effects when combined with various colony-stimulating factors and interleukins. This homodimeric protein, particularly in isoform 2, plays a crucial role in promoting the expansion and differentiation of hematopoietic progenitor cells. Its ability to activate FLT3 and collaborate with other signaling molecules underscores its significance in regulating hematopoiesis and maintaining the balance of the hematopoietic system.

The ED₅₀ is <0.8 ng/mL as measure by its ability to induce proliferation in BaF3 cells transfected with mouse Flt-3, corresponding to a specific activity of recombinant human Flt-3 Ligand is > 1.5 x 10₆ unit/mg.

Human

E. coli

C-His

P49771-1 (T27-A181)

2323  [NCBI]

MTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA

Approximately 18.6 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.