Animal-Free FLT3LG Protein, Mouse (His)

FLT3LG Proteinas, a potent stimulator, activates FLT3, synergizing with colony-stimulating factors and interleukins. Its homodimeric form, especially in the soluble isoform, effectively promotes the expansion and differentiation of hematopoietic progenitor cells. The protein's significance lies in orchestrating key processes within the hematopoietic system. Animal-Free FLT3LG Protein, Mouse (His) is the recombinant mouse-derived animal-FreeFLT3LG protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free FLT3LG Protein, Mouse (His) is 162 a.a., with molecular weight of ~19.3 kDa.

The FLT3LG protein acts as a potent stimulator, fostering the proliferation of early hematopoietic cells through the activation of FLT3. Exhibiting synergistic effects, particularly in its soluble isoform, this homodimeric protein collaborates effectively with various colony-stimulating factors and interleukins. Its role in promoting the expansion and differentiation of hematopoietic progenitor cells underscores its significance in orchestrating key processes within the hematopoietic system.

Measure by its ability to induce proliferation in BaF3 cells transfected with mouse Flt-3. The ED₅₀ for this effect is <2 ng/mL.

Mouse

E. coli

C-His

P49772 (G27-R188)

14256  [NCBI]

MGTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPR

Approximately 19.3 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.