Animal-Free G-CSF Protein, Mouse (His)

The G-CSF Protein, a monomeric cytokine in the granulocyte/macrophage colony-stimulating factor family, crucially regulates hematopoiesis by orchestrating the production, differentiation, and function of granulocytes and monocytes-macrophages. Its production emphasizes its significance in maintaining immune system balance and functionality. Animal-Free G-CSF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeG-CSF protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free G-CSF Protein, Mouse (His) is 178 a.a., with molecular weight of ~19.76 kDa.

The G-CSF Protein, a member of the granulocyte/macrophage colony-stimulating factors, plays a crucial role in hematopoiesis by regulating the production, differentiation, and function of two closely related white cell populations in the blood: granulocytes and monocytes-macrophages. Specifically, this cytokine induces the generation of granulocytes, contributing to the intricate orchestration of hematopoietic processes.

Measure by its ability to induce proliferation in NFS-60 cells. The ED₅₀ for this effect is <50 pg/mL. The specific activity of recombinant mouse G-CSF is >2 x 10⁷ IU/mg.

Mouse

E. coli

N-His

P09920 (V31-A208)

12985  [NCBI]

VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA

Approximately 19.76 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.