1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. CSF & Receptors
  4. G-CSF
  5. Animal-Free G-CSF Protein, Mouse (His)

The G-CSF Protein, a monomeric cytokine in the granulocyte/macrophage colony-stimulating factor family, crucially regulates hematopoiesis by orchestrating the production, differentiation, and function of granulocytes and monocytes-macrophages. Its production emphasizes its significance in maintaining immune system balance and functionality. Animal-Free G-CSF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeG-CSF protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free G-CSF Protein, Mouse (His) is 178 a.a., with molecular weight of ~19.76 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The G-CSF Protein, a monomeric cytokine in the granulocyte/macrophage colony-stimulating factor family, crucially regulates hematopoiesis by orchestrating the production, differentiation, and function of granulocytes and monocytes-macrophages. Its production emphasizes its significance in maintaining immune system balance and functionality. Animal-Free G-CSF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeG-CSF protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free G-CSF Protein, Mouse (His) is 178 a.a., with molecular weight of ~19.76 kDa.

Background

The G-CSF Protein, a member of the granulocyte/macrophage colony-stimulating factors, plays a crucial role in hematopoiesis by regulating the production, differentiation, and function of two closely related white cell populations in the blood: granulocytes and monocytes-macrophages. Specifically, this cytokine induces the generation of granulocytes, contributing to the intricate orchestration of hematopoietic processes.

Biological Activity

Measure by its ability to induce proliferation in NFS-60 cells. The ED50 for this effect is <50 pg/mL. The specific activity of recombinant mouse G-CSF is >2 x 107 IU/mg.

Species

Mouse

Source

E. coli

Tag

N-His

Accession

P09920 (V31-A208)

Gene ID
Molecular Construction
N-term
His
G-CSF (V31-A208)
Accession # P09920
C-term
Synonyms
rMuG-CSF; CSF-3; MGI-1G; Pluripoietin; Molgramostin; Sargramostim
AA Sequence

VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA

Molecular Weight

Approximately 19.76 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free G-CSF Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free G-CSF Protein, Mouse (His)
Cat. No.:
HY-P700178AF
Quantity:
MCE Japan Authorized Agent: