Animal-Free Galectin-12 Protein, Human (His)

Galectin-12 protein exhibits lactose binding, indicating affinity for specific carbohydrate moieties. Some people believe that Galectin-12 may contribute to adipocyte apoptosis, suggesting that it plays a role in the regulation of adipose tissue homeostasis and programmed cell death. Animal-Free Galectin-12 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-12 protein, expressed by E. coli , with N-His labeled tag.

The Galectin-12 Protein exhibits the capability to bind lactose, highlighting its affinity for specific carbohydrate moieties. Additionally, there is a suggestion that Galectin-12 may play a role in the apoptosis of adipocytes, implying its potential involvement in the regulation of adipose tissue homeostasis and cellular processes related to programmed cell death within this context. The binding specificity of Galectin-12 to lactose suggests a targeted influence on carbohydrate-mediated interactions, emphasizing its potential significance in the modulation of cellular functions related to adipocyte biology.

Human

E. coli

N-His

Q96DT0-1 (S2-S336)

85329  [NCBI]

SQPSGGRAPGTRIYSWSCPTVMSPGEKLDPIPDSFILQPPVFHPVVPYVTTIFGGLHAGKMVMLQGVVPLDAHRFQVDFQCGCSLCPRPDIAFHFNPRFHTTKPHVICNTLHGGRWQREARWPHLALRRGSSFLILFLFGNEEVKVSVNGQHFLHFRYRLPLSHVDTLGIFGDILVEAVGFLNINPFVEGSREYPAGHPFLLMSPRLEVPCSHALPQGLSPGQVIIVRGLVLQEPKHFTVSLRDQAAHAPVTLRASFADRTLAWISRWGQKKLISAPFLFYPQRFFEVLLLFQEGGLKLALNGQGLGATSMNQQALEQLRELRISGSVQLYCVHS

Approximately 38.4 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.