1. Recombinant Proteins
  2. Animal-free Recombinant Proteins
  3. Animal-Free Galectin-12 Protein, Human (His)

Animal-Free Galectin-12 Protein, Human (His)

Cat. No.: HY-P700074AF
Handling Instructions Technical Support

Galectin-12 protein exhibits lactose binding, indicating affinity for specific carbohydrate moieties. Some people believe that Galectin-12 may contribute to adipocyte apoptosis, suggesting that it plays a role in the regulation of adipose tissue homeostasis and programmed cell death. Animal-Free Galectin-12 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-12 protein, expressed by E. coli , with N-His labeled tag.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Animal-Free Galectin-12 Protein, Human (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Galectin-12 protein exhibits lactose binding, indicating affinity for specific carbohydrate moieties. Some people believe that Galectin-12 may contribute to adipocyte apoptosis, suggesting that it plays a role in the regulation of adipose tissue homeostasis and programmed cell death. Animal-Free Galectin-12 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-12 protein, expressed by E. coli , with N-His labeled tag.This product is for cell culture use only.

Background

The Galectin-12 Protein exhibits the capability to bind lactose, highlighting its affinity for specific carbohydrate moieties. Additionally, there is a suggestion that Galectin-12 may play a role in the apoptosis of adipocytes, implying its potential involvement in the regulation of adipose tissue homeostasis and cellular processes related to programmed cell death within this context. The binding specificity of Galectin-12 to lactose suggests a targeted influence on carbohydrate-mediated interactions, emphasizing its potential significance in the modulation of cellular functions related to adipocyte biology.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q96DT0-1 (S2-S336)

Gene ID

85329  [NCBI]

Molecular Construction
N-term
His
Galectin-12 (S2-S336)
Accession # Q96DT0-1
C-term
Synonyms
LGALS12; GAL12; GRIP1; Gal-12; Galectin-related inhibitor of proliferation
AA Sequence

SQPSGGRAPGTRIYSWSCPTVMSPGEKLDPIPDSFILQPPVFHPVVPYVTTIFGGLHAGKMVMLQGVVPLDAHRFQVDFQCGCSLCPRPDIAFHFNPRFHTTKPHVICNTLHGGRWQREARWPHLALRRGSSFLILFLFGNEEVKVSVNGQHFLHFRYRLPLSHVDTLGIFGDILVEAVGFLNINPFVEGSREYPAGHPFLLMSPRLEVPCSHALPQGLSPGQVIIVRGLVLQEPKHFTVSLRDQAAHAPVTLRASFADRTLAWISRWGQKKLISAPFLFYPQRFFEVLLLFQEGGLKLALNGQGLGATSMNQQALEQLRELRISGSVQLYCVHS

Molecular Weight

Approximately 38.4 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free Galectin-12 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free Galectin-12 Protein, Human (His)
Cat. No.:
HY-P700074AF
Quantity:
MCE Japan Authorized Agent: