Animal-Free Galectin-13 Protein, Human (His)

Galectin-13 Protein, with beta-galactoside and lactose binding capacity, acts as a potent inducer of T-cell apoptosis, as confirmed by research findings. It also exhibits hemagglutinating activity towards chicken erythrocytes, as reported in studies. Structurally, Galectin-13 Protein exists as a homodimer, maintained by disulfide linkages contributing to its dimeric form. Animal-Free Galectin-13 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-13 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free Galectin-13 Protein, Human (His) is 138 a.a., with molecular weight of ~16.9 kDa.

The Galectin-13 Protein exhibits the capacity to bind to beta-galactoside and lactose, and it functions as a potent inducer of T-cell apoptosis, as supported by research findings. Additionally, this protein demonstrates hemagglutinating activity towards chicken erythrocytes, as reported in studies. Structurally, Galectin-13 Protein exists as a homodimer, with disulfide linkages contributing to its dimeric form.

Human

E. coli

N-His

Q9UHV8 (S2-N139)

29124  [NCBI]

SSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN

Approximately 16.9 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<0.1 EU per 1 μg of the protein by the LAL method.