Animal-Free Galectin-14/LGALS14 Protein, Human (His)

Galectin-14/LGALS14 protein has the ability to bind β-galactoside and lactose and can serve as an effective inducer of T cell apoptosis, highlighting its key role in the regulation of immune responses. Animal-Free Galectin-14/LGALS14 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-14/LGALS14 protein, expressed by E. coli , with N-His labeled tag.

The Galectin-14/LGALS14 Protein demonstrates the ability to bind to beta-galactoside and lactose. Notably, it serves as a robust inducer of T-cell apoptosis, showcasing its functional significance in regulating immune responses. The specific binding to beta-galactoside and lactose suggests a role in cellular processes mediated by these molecules, emphasizing the diverse functions of Galectin-14/LGALS14 in modulating immune activity and potentially contributing to broader physiological processes.

Human

E. coli

N-His

Q8TCE9-1 (S2-D139)

56891  [NCBI]

SSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSCVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVFRDISLTRVLISD

Approximately 16.9 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.