Animal-Free Galectin-16 Protein, Human (His)

Galectin-16 is a soluble β-galactoside binding protein that regulates key biological processes such as cell growth, differentiation, apoptosis and immune response. Galectin-16 alters expression associated with cancer, diabetes, and brain disease. Animal-Free Galectin-16 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-16 protein, expressed by E. coli , with N-His labeled tag.

Galactoside is a soluble β-galactoside binding protein that regulates key biological processes such as cell growth, differentiation, apoptosis and immune response. Galectin-16 may regulate signal transduction pathways via c-Rel hubs in B cells or T cells at the maternal-fetal interface. Galectin-16 alters expression associated with cancer, diabetes, and brain disease^[1][2][3].

Human

E. coli

N-His

A8MUM7 (S2-R142)

148003  [NCBI]

SFLTVPYKLPVSLSVGSCVIIKGTLIDSSINEPQLQVDFYTEMNEDSEIAFHLRVHLGRRVVMNSREFGIWMLEENLHYVPFEDGKPFDLRIYVCLNEYEVKVNGEYIYAFVHRIPPSYVKMIQVWRDVSLDSVLVNNGRR

Approximately 17.4 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<0.1 EU per 1 μg of the protein by the LAL method.