1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. TGF-beta Superfamily
  4. Bone Morphogenetic Proteins (BMPs)
  5. BMP-11/GDF-11
  6. Animal-Free GDF-11/BMP-11 Protein, Human (His)

Animal-Free GDF-11/BMP-11 Protein, Human (His)

Cat. No.: HY-P700020AF
SDS COA Handling Instructions

Bone morphogenetic protein 11 (BMP-11; GDF11), also known as growth/differentiation factor 11, is a polymorphic ligand protein belonging to the TGFβ family. The GDF-11/BMP-11 signal activates the signal through activator receptor types I and II, resulting in the phosphorylation of SMAD2 and SMAD3. GDF-11/BMP-11 is an important regulator of central nervous system (CNS) formation and fate. Exogenous peripheral delivery of GDF-11/BMP-11 may enhance neurogenesis and angiogenesis and improve neuropathological outcomes in the elderly brain. The total length of human GDF-11/BMP-11 protein is 407 amino acids (M1-M407), with a glycosylation domain. Animal-Free GDF-11/BMP-11 Protein, Human (His) has a total length of 109 amino acids (N299-S407), is expressed in E. coli with C-terminal His-tag.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Bone morphogenetic protein 11 (BMP-11; GDF11), also known as growth/differentiation factor 11, is a polymorphic ligand protein belonging to the TGFβ family. The GDF-11/BMP-11 signal activates the signal through activator receptor types I and II, resulting in the phosphorylation of SMAD2 and SMAD3[1]. GDF-11/BMP-11 is an important regulator of central nervous system (CNS) formation and fate[2]. Exogenous peripheral delivery of GDF-11/BMP-11 may enhance neurogenesis and angiogenesis and improve neuropathological outcomes in the elderly brain[2]. The total length of human GDF-11/BMP-11 protein is 407 amino acids (M1-M407), with a glycosylation domain. Animal-Free GDF-11/BMP-11 Protein, Human (His) has a total length of 109 amino acids (N299-S407), is expressed in E. coli with C-terminal His-tag.

Background

Bone Morphogenetic Protein 11 (BMP-11; GDF11), also known as growth/differentiation factor 11, is a ligand protein with pleiotropic, belongs to TGFβ family. BMP-11 signals through activin receptors type II, ACVR2A and ACVR2B, and activin receptors type I, ACVR1B, ACVR1C and TGFBR1 leading to the phosphorylation of SMAD2 and SMAD3[1].
BMP-11 is highly similar with growth/differentiation factor 8 (GDF8), and exhibits more potent activator of SMAD2/3 and signals more effectively through the type I activin-like receptor kinase receptors ALK4/5/7 than GDF8. Furthermore, signaling by GDF-11/BMP-11 is controlled by extracellular protein antagonists, including FS, FSTL3, GASP1, and GASP2[1].
GDF-11/BMP-11 plays pivotal roles during development, including anterior/posterior patterning, formation of the kidney, stomach, spleen and endocrine pancreas. In the embryo, BMP-11 also shows strong expression is seen in the palatal epithelia, including the medial edge epithelial and midline epithelial seam of the palatal shelves. Less pronounced expression is also seen throughout the palatal shelf and tongue mesenchyme[3].
GDF-11/BMP-11 is lately found expressing in the adult central nervous system (CNS)[3], is an important regulator of CNS formation and fate[2]. In the aged brain, exogenous, peripherally delivered GDF-11/BMP-11 may enhance neurogenesis and angiogenesis, as well as improve neuropathological outcomes. Exogenously increasing circulating GDF-11/BMP-11 concentrations may be a viable approach for improving deleterious aspects of brain aging and neuropathology[2].

In Vitro

GDF-11/BMP-11 (5, 1, 2, and 4 ng/mL; 7 d) maintains the colony and cellular morphology of undifferentiated human embryonic stem cells (hESC), maintains POU5f1, NANOG, TRA-1-6, and SSEA4 expression, and displays increased SMAD2/3 phosphorylation in serum-free medium at 2 ng/mL concentration[4].
GDF-11/BMP-11 (5-4 ng/mL; 2 d) induces browning of 3T3-L1 adipocytes via coordination of multiple signalling pathways, including mTORC1-COX2 and p38MAPK-PGC-1α as non-canonical pathways, as well as Smad1/5/8 as a canonical pathway[5].

Biological Activity

1.Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <11 ng/mL.
2.Measure by its ability to induce hemoglobin expression in K562 cells. The ED50 for this effect is <4 ng/mL.

Species

Human

Source

E. coli

Tag

C-His

Accession

O95390 (N299-S407)

Gene ID
Molecular Construction
N-term
BMP-11 (N299-S407)
Accession # O95390
His
C-term
Synonyms
Growth/Differentiation Factor-11; GDF-11
AA Sequence

MNLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS

Molecular Weight

Approximately 13.40 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free GDF-11/BMP-11 Protein, Human (His)
Cat. No.:
HY-P700020AF
Quantity:
MCE Japan Authorized Agent: