1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. TGF-beta Superfamily
  4. Growth Differentiation Factor
  5. Growth Differentiation Factor 7 (GDF-7/BMP-12)
  6. Animal-Free BMP-12/GDF-7 Protein, Human (His)

Animal-Free BMP-12/GDF-7 Protein, Human (His)

Cat. No.: HY-P700021AF
SDS COA Handling Instructions Technical Support

BMP-12/GDF-7 Protein, existing as a homodimer with disulfide linkages, is hypothesized to influence the motor area of the primate neocortex. Its distinct structural characteristics suggest a unique mode of action, possibly contributing to cellular events integral to motor area function. The precise details of BMP-12/GDF-7 Protein's role in this neural context and its implications in motor-related processes await further research. Animal-Free BMP-12/GDF-7 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-12/GDF-7 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free BMP-12/GDF-7 Protein, Human (His) is 129 a.a., with molecular weight of ~14.95 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Animal-Free BMP-12/GDF-7 Protein, Human (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BMP-12/GDF-7 Protein, existing as a homodimer with disulfide linkages, is hypothesized to influence the motor area of the primate neocortex. Its distinct structural characteristics suggest a unique mode of action, possibly contributing to cellular events integral to motor area function. The precise details of BMP-12/GDF-7 Protein's role in this neural context and its implications in motor-related processes await further research. Animal-Free BMP-12/GDF-7 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-12/GDF-7 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free BMP-12/GDF-7 Protein, Human (His) is 129 a.a., with molecular weight of ~14.95 kDa.

Background

BMP-12/GDF-7 Protein is postulated to play an active role, potentially exerting its influence in the motor area of the primate neocortex. Existing as a homodimer with disulfide-linkages, this protein's specific mechanisms and molecular interactions within the motor area remain to be fully elucidated. The distinct structural characteristics of the homodimer suggest a unique mode of action, possibly contributing to cellular events that are integral to the function and regulation of the motor area in the primate neocortex. Further research is warranted to uncover the precise details of BMP-12/GDF-7 Protein's role in this neural context and its potential implications in motor-related processes.

Biological Activity

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <112 ng/mL

Species

Human

Source

E. coli

Tag

C-His

Accession

Q7Z4P5 (T322-R450)

Gene ID
Molecular Construction
N-term
BMP-12 (T322-R450)
Accession # Q7Z4P5
His
C-term
Synonyms
Growth/Differentiation Factor-7; GDF-7
AA Sequence

MTALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR

Molecular Weight

Approximately 14.95 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free BMP-12/GDF-7 Protein, Human (His)
Cat. No.:
HY-P700021AF
Quantity:
MCE Japan Authorized Agent: