1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. CSF & Receptors
  4. GM-CSF
  5. Animal-Free GM-CSF Protein, Pig (His)

The GM-CSF protein acts as a potent cytokine that coordinates the growth and differentiation of hematopoietic precursor cells of different lineages, including granulocytes, macrophages, eosinophils, and erythrocytes. Structurally, GM-CSF exists as a monomer and its signaling is mediated through a dodecamer complex. Animal-Free GM-CSF Protein, Pig (His) is the recombinant pig-derived animal-FreeGM-CSF protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free GM-CSF Protein, Pig (His) is 127 a.a., with molecular weight of ~15.3 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GM-CSF protein acts as a potent cytokine that coordinates the growth and differentiation of hematopoietic precursor cells of different lineages, including granulocytes, macrophages, eosinophils, and erythrocytes. Structurally, GM-CSF exists as a monomer and its signaling is mediated through a dodecamer complex. Animal-Free GM-CSF Protein, Pig (His) is the recombinant pig-derived animal-FreeGM-CSF protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free GM-CSF Protein, Pig (His) is 127 a.a., with molecular weight of ~15.3 kDa.

Background

GM-CSF Protein serves as a potent cytokine, orchestrating the growth and differentiation of hematopoietic precursor cells across diverse lineages, including granulocytes, macrophages, eosinophils, and erythrocytes. Structurally, GM-CSF exists as a monomer, and its signaling is mediated through a dodecameric complex. This complex comprises two head-to-head hexamers, each featuring two alpha, two beta, and two ligand subunits, underscoring the intricacy of the receptor assembly and the specificity of GM-CSF in modulating cellular responses.

Biological Activity

Measure by its ability to induce proliferationin TF-1 cells. The ED50 for this effect is <3 ng/mL.

Species

Pig

Source

E. coli

Tag

N-His

Accession

Q29118 (A18-K144)

Gene ID
Molecular Construction
N-term
His
GM-CSF (A18-K144)
Accession # Q29118
C-term
Synonyms
CSF2
AA Sequence

APTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK

Molecular Weight

Approximately 15.3 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free GM-CSF Protein, Pig (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free GM-CSF Protein, Pig (His)
Cat. No.:
HY-P700239AF
Quantity:
MCE Japan Authorized Agent: