Animal-Free I-TAC/CXCL11 Protein, Human (His)

I-TAC/CXCL11 protein selectively attracts interleukin-activated T-cells, inducing calcium release and binding to CXCR3 receptors. It does not attract unstimulated T-cells, neutrophils, or monocytes. This protein may play a role in T-cell recruitment in central nervous system diseases and skin immune responses. It also interacts with TNFAIP6, potentially modulating inflammatory processes. Animal-Free I-TAC/CXCL11 Protein, Human (His) is the recombinant human-derived animal-FreeI-TAC/CXCL11 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free I-TAC/CXCL11 Protein, Human (His) is 73 a.a., with molecular weight of ~9.11 kDa.

I-TAC/CXCL11 protein demonstrates chemotactic activity specifically for interleukin-activated T-cells while not attracting unstimulated T-cells, neutrophils, or monocytes. It induces calcium release specifically in activated T-cells and binds to CXCR3 receptors. This protein may have a significant role in central nervous system diseases that involve T-cell recruitment, as well as in skin immune responses. Additionally, it interacts with TNFAIP6 through its Link domain, suggesting potential involvement in modulating inflammatory processes.

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR3. The ED₅₀ for this effect is <4 ng/mL.

Human

E. coli

N-His

O14625 (F22-F94)

6373  [NCBI]

FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF

Approximately 9.11 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.