1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. I-TAC/CXCL11
  6. Animal-Free I-TAC/CXCL11 Protein, Human (His)

Animal-Free I-TAC/CXCL11 Protein, Human (His)

Cat. No.: HY-P700042AF
Handling Instructions Technical Support

I-TAC/CXCL11 protein selectively attracts interleukin-activated T-cells, inducing calcium release and binding to CXCR3 receptors. It does not attract unstimulated T-cells, neutrophils, or monocytes. This protein may play a role in T-cell recruitment in central nervous system diseases and skin immune responses. It also interacts with TNFAIP6, potentially modulating inflammatory processes. Animal-Free I-TAC/CXCL11 Protein, Human (His) is the recombinant human-derived animal-FreeI-TAC/CXCL11 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

I-TAC/CXCL11 protein selectively attracts interleukin-activated T-cells, inducing calcium release and binding to CXCR3 receptors. It does not attract unstimulated T-cells, neutrophils, or monocytes. This protein may play a role in T-cell recruitment in central nervous system diseases and skin immune responses. It also interacts with TNFAIP6, potentially modulating inflammatory processes. Animal-Free I-TAC/CXCL11 Protein, Human (His) is the recombinant human-derived animal-FreeI-TAC/CXCL11 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Background

I-TAC/CXCL11 protein demonstrates chemotactic activity specifically for interleukin-activated T-cells while not attracting unstimulated T-cells, neutrophils, or monocytes. It induces calcium release specifically in activated T-cells and binds to CXCR3 receptors. This protein may have a significant role in central nervous system diseases that involve T-cell recruitment, as well as in skin immune responses. Additionally, it interacts with TNFAIP6 through its Link domain, suggesting potential involvement in modulating inflammatory processes.

Biological Activity

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR3. The ED50 for this effect is <4 ng/mL.

Species

Human

Source

E. coli

Tag

N-His

Accession

O14625 (F22-F94)

Gene ID
Molecular Construction
N-term
His
CXCL11 (F22-F94)
Accession # O14625
C-term
Synonyms
I-TAC/CXCL11; C-X-C motif chemokine 11; Beta-R1; H174; IP-9; SCYB11
AA Sequence

FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF

Molecular Weight

Approximately 9.11 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free I-TAC/CXCL11 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free I-TAC/CXCL11 Protein, Human (His)
Cat. No.:
HY-P700042AF
Quantity:
MCE Japan Authorized Agent: