1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interferon & Receptors
  4. IFN-alpha
  5. IFN-alpha 1
  6. Animal-Free IFN alpha 1a Protein, Mouse (His)

Animal-Free IFN alpha 1a Protein, Mouse (His)

Cat. No.: HY-P700183AF
COA Handling Instructions

IFN alpha 1a Protein, synthesized by macrophages, exhibits robust antiviral activities by stimulating key enzymes—a protein kinase and an oligoadenylate synthetase. This orchestrated molecular response enhances the host's immune defenses against viral threats. Animal-Free IFN alpha 1a Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIFN alpha 1a protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free IFN alpha 1a Protein, Mouse (His) is 166 a.a., with molecular weight of ~19.93 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $125 In-stock
50 μg $350 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IFN alpha 1a Protein, synthesized by macrophages, exhibits robust antiviral activities by stimulating key enzymes—a protein kinase and an oligoadenylate synthetase. This orchestrated molecular response enhances the host's immune defenses against viral threats. Animal-Free IFN alpha 1a Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIFN alpha 1a protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free IFN alpha 1a Protein, Mouse (His) is 166 a.a., with molecular weight of ~19.93 kDa.

Background

IFN alpha 1a Protein, synthesized by macrophages, possesses potent antiviral activities. Its primary role involves the stimulation of two pivotal enzymes—a protein kinase and an oligoadenylate synthetase. This orchestrated molecular response plays a crucial part in enhancing the host's immune defenses against viral threats.

Biological Activity

Measure by its ability to protect L929 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is <10 pg/mL. The specific activity of recombinant mouse IFN alpha 1a is >4 x107 IU/mg.

Species

Mouse

Source

E. coli

Tag

N-His

Accession

P01572 (C24-K189)

Gene ID
Molecular Construction
N-term
His
IFN alpha 1a (C24-K189)
Accession # P01572
C-term
Synonyms
Interferon alpha 1a; Ifa; Ifa8; IFNA
AA Sequence

CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK

Molecular Weight

Approximately 19.93 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IFN alpha 1a Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IFN alpha 1a Protein, Mouse (His)
Cat. No.:
HY-P700183AF
Quantity:
MCE Japan Authorized Agent: