1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interferon & Receptors
  4. IFN-beta
  5. Animal-Free IFN-beta Protein, Human (His)

PDGF R beta protein is a receptor protein that binds to platelet-derived growth factor (PDGF). It is expressed in a variety of cells, including fibroblasts and smooth muscle cells. Animal-Free IFN-beta Protein, Human (His) is the recombinant human-derived animal-FreeIFN-beta protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PDGF R beta protein is a receptor protein that binds to platelet-derived growth factor (PDGF). It is expressed in a variety of cells, including fibroblasts and smooth muscle cells. Animal-Free IFN-beta Protein, Human (His) is the recombinant human-derived animal-FreeIFN-beta protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

Background

The IFN-beta Protein encodes a cytokine belonging to the interferon family, released as part of the innate immune response against pathogens. This protein falls under the type I class of interferons, crucial for defense against viral infections, as well as participating in cell differentiation and anti-tumor defenses. Upon secretion in response to pathogens, type I interferons bind a homologous receptor complex, triggering the transcription of genes involved in inflammatory cytokines and chemokines. Aberrant activation of type I interferon secretion is associated with autoimmune diseases. Mice deficient for this gene exhibit several phenotypes, including defects in B cell maturation and increased susceptibility to viral infection, emphasizing the pivotal role of IFN-beta Protein in immune responses and host defense.

Biological Activity

1.Measure by its ability to induce apoptosis in HeLa cells. The ED50 for this effect is <15 ng/mL.
2.Measure by its ability to induce cytotoxicity in TF-1 cells. The ED50 for this effect is <0.1 ng/mL. The specific activity of recombinant human IFN beta 1a is approximately >1 x107 IU/ mg.

Species

Human

Source

E. coli

Tag

C-His

Accession

P01574/NP_002167.1 (M22-N187)

Gene ID
Molecular Construction
N-term
IFN-beta (M22-N187)
Accession # P01574/NP_002167.1
His
C-term
Synonyms
IFNB1; Type I Interferon
AA Sequence

MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN

Molecular Weight

Approximately 20.84 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IFN-beta Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IFN-beta Protein, Human (His)
Cat. No.:
HY-P700090AF
Quantity:
MCE Japan Authorized Agent: