Animal-Free IFN-beta Protein, Human (His)

PDGF R beta protein is a receptor protein that binds to platelet-derived growth factor (PDGF). It is expressed in a variety of cells, including fibroblasts and smooth muscle cells. Animal-Free IFN-beta Protein, Human (His) is the recombinant human-derived animal-FreeIFN-beta protein, expressed by E. coli , with C-His labeled tag.

The IFN-beta Protein encodes a cytokine belonging to the interferon family, released as part of the innate immune response against pathogens. This protein falls under the type I class of interferons, crucial for defense against viral infections, as well as participating in cell differentiation and anti-tumor defenses. Upon secretion in response to pathogens, type I interferons bind a homologous receptor complex, triggering the transcription of genes involved in inflammatory cytokines and chemokines. Aberrant activation of type I interferon secretion is associated with autoimmune diseases. Mice deficient for this gene exhibit several phenotypes, including defects in B cell maturation and increased susceptibility to viral infection, emphasizing the pivotal role of IFN-beta Protein in immune responses and host defense.

1.Measure by its ability to induce apoptosis in HeLa cells. The ED₅₀ for this effect is <15 ng/mL.
2.Measure by its ability to induce cytotoxicity in TF-1 cells. The ED₅₀ for this effect is <0.1 ng/mL. The specific activity of recombinant human IFN beta 1a is approximately >1 x10⁷ IU/ mg.

Human

E. coli

C-His

P01574/NP_002167.1 (M22-N187)

3456  [NCBI]

MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN

Approximately 20.84 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.