1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interferon & Receptors
  4. IFN-γ
  5. Animal-Free IFN-gamma Protein, Mouse (His)

Animal-Free IFN-gamma Protein, Mouse (His)

Cat. No.: HY-P700184AF
COA Handling Instructions

IFN-gamma is a type II interferon family cytokine that participates in antiviral, antibacterial, and antitumor responses. Animal-Free IFN-gamma Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIFN-gamma protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IFN-gamma Protein, Mouse (His) is 133 a.a., with molecular weight of ~16.5 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
2 μg $35 In-stock
10 μg $75 In-stock
50 μg $190 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IFN-gamma is a type II interferon family cytokine that participates in antiviral, antibacterial, and antitumor responses. Animal-Free IFN-gamma Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIFN-gamma protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IFN-gamma Protein, Mouse (His) is 133 a.a., with molecular weight of ~16.5 kDa.

Background

IFN-gamma is produced by immune cells such as T cells and NK cells, and plays a key role in antibacterial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation[1][2][5][6].FN-gamma is involved in the regulation of hematopoietic stem cells under developmental and steady-state conditions by affecting their development, quiescence, and differentiation[3][4].IFN-gamma increases the susceptibility of cancer cells to external and internal apoptosis pathways by regulating the expression of Fas/FasL, TNF-related apoptosis-inducing ligand (TRAIL), caspase-8, -3, -7, and -1, survivin, and Bim[5].IFN-gamma mainly interacts with its receptor IFNGR1 through the JAK-STAT pathway to affect gene regulation. After binding to the receptor, the intracellular domain of IFNGR1 opens, allowing downstream signaling elements JAK2, JAK1, and STAT1 to bind, resulting in STAT1 activation, nuclear translocation, and IFN-gamma-regulated gene transcription[6].IFN-gamma achieves antiviral effects by inducing RNA-activated protein kinase R (PKR) and adenosine deaminase RNA-specific-1 (ADAR-1) to activate antiviral proteins[6].IFN-gamma can inhibit the production of IL-4 by TH1 cells and maintain the sustained expression of T-bet[7].As a central effector of cell-mediated immunity, IFN-gamma can enhance antigen recognition through interactions with homologous T cells, amplify antigen presentation through antigen-presenting cells (APCs), increase the production of reactive oxygen species (ROS) and reactive nitrogen intermediates (RNIs), and induce antiviral responses[8].

Biological Activity

Measure by its ability to anti-viral assay in L-929 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is <0.5 ng/mL. The specific activity of recombinant mouse IFN gamma is approximately >2x106 IU/mg

Species

Mouse

Source

E. coli

Tag

C-His

Accession

P01580 (H23-C155)

Gene ID

15978  [NCBI]

Molecular Construction
N-term
IFN-gamma (H23-C155)
Accession # P01580
His
C-term
Synonyms
rMuIFN-γ; IFNG; IFN-gamma; Interferon gamma
AA Sequence

MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC

Molecular Weight

Approximately 16.5 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.01 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IFN-gamma Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IFN-gamma Protein, Mouse (His)
Cat. No.:
HY-P700184AF
Quantity:
MCE Japan Authorized Agent: