Animal-Free IFN-lambda 3/IL-28B Protein, Mouse (His)

The IFN-lambda 3/IL-28B protein is a cytokine with antiviral, antitumor, and immunomodulatory properties that is critical for defense against viruses, especially in epithelial tissues. It acts as a ligand for IL10RB and IFNLR1 receptor complexes, activating the JAK/STAT signaling pathway and inducing IFN-stimulated genes (ISG) into an antiviral state. Animal-Free IFN-lambda 3/IL-28B Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIFN-lambda 3/IL-28B protein, expressed by E. coli , with C-His labeled tag.

IFN-lambda 3/IL-28B Protein is a cytokine that exhibits antiviral, antitumour, and immunomodulatory properties. It plays a crucial role in the host defense against viruses, particularly in epithelial tissues. This protein acts as a ligand for the IL10RB and IFNLR1 receptor complex, leading to the activation of the JAK/STAT signaling pathway and the expression of IFN-stimulated genes (ISG) that contribute to the antiviral state. Its receptor is primarily expressed in epithelial cells, which explains its cell type-selective action. Although it may not be essential for early host defense in vaginal infections, it plays a significant role in Toll-like receptor (TLR)-induced antiviral defense and the immune defense in the intestinal epithelium. Furthermore, IFN-lambda 3/IL-28B Protein also exerts an immunomodulatory effect by up-regulating MHC class I antigen expression.

Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED₅₀ for this effect is <20 ng/mL.

Mouse

E. coli

C-His

Q8CGK6 (D20-V193)

338374  [NCBI]

MDPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKGAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENINDSALTTILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFQLLLRDLKCVASGDQCV

Approximately 20.56 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.