Animal-Free IGF-I Protein, Pig (His)

The IGF-I protein is structurally similar to insulin and has excellent growth-promoting activity. As a potential physiological regulator, it affects [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Animal-Free IGF-I Protein, Pig (His) is the recombinant pig-derived animal-FreeIGF-I protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IGF-I Protein, Pig (His) is 70 a.a., with molecular weight of ~8.59 kDa.

The IGF-I protein, sharing structural and functional similarities with insulin, surpasses its counterpart in growth-promoting activity. It potentially acts as a physiological regulator, influencing [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Demonstrating efficacy in stimulating glucose transport in bone-derived osteoblastic (PyMS) cells at significantly lower concentrations than insulin, IGF-I extends its impact to glycogen and DNA synthesis, as well as enhanced glucose uptake. With a potential role in synapse maturation, IGF-I is implicated in Ca(2+)-dependent exocytosis essential for sensory perception of smell in the olfactory bulb. Functioning as a ligand for IGF1R, it binds to the alpha subunit, initiating the activation of intrinsic tyrosine kinase activity, leading to a cascade of downstream signaling events, including the activation of the PI3K-AKT/PKB and Ras-MAPK pathways. Essential for IGF1 signaling, IGF-I forms crucial ternary complexes with integrins (ITGAV:ITGB3 and ITGA6:ITGB4) and IGFR1, influencing the phosphorylation and activation of IGFR1, MAPK3/ERK1, MAPK1/ERK2, and AKT1.

Pig

E. coli

C-His

P16545 (G49-A118)

397491  [NCBI]

MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Approximately 8.59 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<0.1 EU per 1 μg of the protein by the LAL method.