Animal-Free IGF-II Protein, Mouse (His)

The IGF-II protein plays a crucial role in glucose-mediated insulin secretion, acting together with insulin as a physiological amplifier. Furthermore, it exhibits osteogenic properties by enhancing osteoblast mitotic activity through phosphorylation of MAPK1 and MAPK3. Animal-Free IGF-II Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIGF-II protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free IGF-II Protein, Mouse (His) is 67 a.a., with molecular weight of ~8.20 kDa.

The IGF-II protein emerges as a key factor in glucose-mediated insulin secretion, co-secreted with insulin and functioning as a physiological amplifier for this process. Notably, IGF-II demonstrates osteogenic properties by enhancing osteoblast mitogenic activity through the phosphoactivation of MAPK1 and MAPK3. This dual role underscores the protein's significance in both glucose homeostasis and bone metabolism, highlighting its potential therapeutic relevance in contexts related to insulin secretion and bone health.

Measure by its ability to induce MCF-7 cells proliferation. The ED₅₀ for this effect is <6 ng/mL. The specific activity of recombinant mouse IGF-II is >1.5 x 10⁵ IU/mg.

Mouse

E. coli

N-His

D3Z4N4 (A25-E91)

16002

AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE

Approximately 8.20 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.