1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors Neurotrophic Factors
  4. IL-1
  5. IL-1 beta
  6. Animal-Free IL-1 beta Protein, Mouse (His)

IL-1 beta protein is a potent pro-inflammatory cytokine and major endogenous pyrogen that induces immune cell effects such as prostaglandin synthesis, neutrophil activation, T- and B-cell activation, and fibroblast proliferation . It promotes Th17 differentiation and synergizes with IL12 to promote Th1 IFNG synthesis. Animal-Free IL-1 beta Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 beta protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-1 beta Protein, Mouse (His) is 152 a.a., with molecular weight of ~18.3 kDa.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-1 beta protein is a potent pro-inflammatory cytokine and major endogenous pyrogen that induces immune cell effects such as prostaglandin synthesis, neutrophil activation, T- and B-cell activation, and fibroblast proliferation . It promotes Th17 differentiation and synergizes with IL12 to promote Th1 IFNG synthesis. Animal-Free IL-1 beta Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 beta protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-1 beta Protein, Mouse (His) is 152 a.a., with molecular weight of ~18.3 kDa.This product is for cell culture use only.

Background

IL-1 beta Protein is a potent pro-inflammatory cytokine that was initially discovered as the major endogenous pyrogen. It has various effects on immune cells, such as inducing prostaglandin synthesis, activating neutrophils, promoting T-cell activation and cytokine production, stimulating B-cell activation and antibody production, and increasing fibroblast proliferation and collagen production. IL-1 beta Protein also plays a role in promoting the differentiation of Th17 cells and works synergistically with IL12 to induce the synthesis of IFNG by Th1 cells. Moreover, it contributes to angiogenesis by inducing VEGF production in collaboration with TNF and IL6. IL-1 beta Protein is involved in the transduction of inflammation downstream of pyroptosis, where its mature form is specifically released into the extracellular environment through the gasdermin-D (GSDMD) pore. It exists as a monomer and interacts with MEFV, as well as integrins ITGAV:ITGBV and ITGA5:ITGB1, which are required for IL1B signaling. IL-1 beta Protein also interacts with the cargo receptor TMED10 and HSP90AB1 and HSP90B1, which facilitate the translocation of cargo into the ERGIC.

Biological Activity

Measure by its ability to induce D10.G4.1 cells proliferation. The ED50 for this effect is< 8 pg/mL. The specific activity of recombinan tmouse IL-1 beta is approximately >1.2x 108 IU/mg/.

Species

Mouse

Source

E. coli

Tag

C-His

Accession

P10749 (V118-S269)

Gene ID
Molecular Construction
N-term
IL-1β (V118-S269)
Accession # P10749
His
C-term
Synonyms
rMuIL-1β; Catabolin; IL1F2; IL-1 beta; IL1B
AA Sequence

MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

Molecular Weight

Approximately 18.3 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-1 beta Protein, Mouse (His)
Cat. No.:
HY-P700187AF
Quantity:
MCE Japan Authorized Agent: