Animal-Free IL-10 Protein, Mouse (His)

IL-10 protein is a key immunomodulator that, by binding to its heterotetrameric receptors (IL10RA and IL10RB), activates JAK1 and STAT2 (the latter phosphorylates STAT3), thereby triggering potent anti-inflammatory effects. Phosphorylated STAT3 translocates to the nucleus and promotes the expression of anti-inflammatory mediators. Animal-Free IL-10 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-10 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-10 Protein, Mouse (His) is 160 a.a., with molecular weight of ~19.69 kDa.

IL-10, a major immune regulatory cytokine, exerts profound anti-inflammatory functions, mitigating excessive tissue disruption caused by inflammation. Upon binding to its heterotetrameric receptor, comprising IL10RA and IL10RB, IL-10 initiates a signaling cascade involving JAK1 and STAT2-mediated phosphorylation of STAT3. Subsequently, phosphorylated STAT3 translocates to the nucleus, where it drives the expression of anti-inflammatory mediators. IL-10 specifically targets antigen-presenting cells (APCs), such as macrophages and monocytes, inhibiting their release of pro-inflammatory cytokines, including GM-CSF, G-CSF, IL-1 alpha, IL-1 beta, IL-6, IL-8, and TNF-alpha. Additionally, IL-10 interferes with antigen presentation by reducing the expression of MHC-class II and co-stimulatory molecules, thereby dampening their ability to induce T cell activation. Furthermore, IL-10 controls the inflammatory response of macrophages by reprogramming essential metabolic pathways, including mTOR signaling. IL-10 exists as a homodimer and interacts with IL10RA and IL10RB.

Measure by its ability to induce MC/9- 2 cells prolferation. The ED₅₀ for this effect is <1 ng/mL. The specific activity of recombinant mouse IL-10 is>1 x 10⁶ IU/mg.

Mouse

E. coli

C-His

P18893 (S19-S178)

16153  [NCBI]

MSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS

Approximately 19.69 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.