Animal-Free IL-10 Protein, Pig (His)

IL-10 Protein, a key immune regulator, mitigates inflammation by binding to its receptor (IL10RA/IL10RB), activating JAK1 and STAT2, leading to STAT3-mediated anti-inflammatory gene expression. IL-10 targets APCs, reducing pro-inflammatory cytokines and hindering antigen presentation. It controls macrophage inflammation through metabolic reprogramming. Existing as a homodimer, IL-10 interacts with IL10RA/IL10RB. Animal-Free IL-10 Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-10 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-10 Protein, Pig (His) is 157 a.a., with molecular weight of ~19.1 kDa.

IL-10, a major immune regulatory cytokine, plays a pivotal role in modulating the immune system by exerting profound anti-inflammatory functions, effectively limiting excessive tissue disruption caused by inflammation. Mechanistically, IL-10 binds to its heterotetrameric receptor, composed of IL10RA and IL10RB, initiating JAK1 and STAT2-mediated phosphorylation of STAT3. Subsequently, phosphorylated STAT3 translocates to the nucleus, driving the expression of anti-inflammatory mediators. IL-10 specifically targets antigen-presenting cells (APCs), such as macrophages and monocytes, curbing their release of pro-inflammatory cytokines, including GM-CSF, G-CSF, IL-1 alpha, IL-1 beta, IL-6, IL-8, and TNF-alpha. Additionally, IL-10 interferes with antigen presentation by diminishing the expression of MHC-class II and co-stimulatory molecules, thereby hindering their capacity to induce T cell activation. Moreover, IL-10 maintains control over the inflammatory response of macrophages by reprogramming essential metabolic pathways, including mTOR signaling. Structurally, IL-10 forms a homodimer and engages with IL10RA and IL10RB in its regulatory functions.

Pig

E. coli

C-His

Q29055 (S19-N175)

397106  [NCBI]

MSIKSENSCIHFPTSLPHMLRELRAAFGPVKSFFQTKDQMGDLLLTGSLLEDFKGYLGCQALSEMIQFYLEDVMPKAESDGEDIKEHVNSLGEKLKTLRLRLRRCHQFLPCENKSKAVEEVKSAFSKLQERGVYKAMGEFDIFINYIEAYMTMKMRKN

Approximately 19.1 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<0.01 EU per 1 μg of the protein by the LAL method.