1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-10
  5. Animal-Free IL-10 Protein, Pig (His)

IL-10 Protein, a key immune regulator, mitigates inflammation by binding to its receptor (IL10RA/IL10RB), activating JAK1 and STAT2, leading to STAT3-mediated anti-inflammatory gene expression. IL-10 targets APCs, reducing pro-inflammatory cytokines and hindering antigen presentation. It controls macrophage inflammation through metabolic reprogramming. Existing as a homodimer, IL-10 interacts with IL10RA/IL10RB. Animal-Free IL-10 Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-10 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-10 Protein, Pig (His) is 157 a.a., with molecular weight of ~19.1 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-10 Protein, a key immune regulator, mitigates inflammation by binding to its receptor (IL10RA/IL10RB), activating JAK1 and STAT2, leading to STAT3-mediated anti-inflammatory gene expression. IL-10 targets APCs, reducing pro-inflammatory cytokines and hindering antigen presentation. It controls macrophage inflammation through metabolic reprogramming. Existing as a homodimer, IL-10 interacts with IL10RA/IL10RB. Animal-Free IL-10 Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-10 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-10 Protein, Pig (His) is 157 a.a., with molecular weight of ~19.1 kDa.

Background

IL-10, a major immune regulatory cytokine, plays a pivotal role in modulating the immune system by exerting profound anti-inflammatory functions, effectively limiting excessive tissue disruption caused by inflammation. Mechanistically, IL-10 binds to its heterotetrameric receptor, composed of IL10RA and IL10RB, initiating JAK1 and STAT2-mediated phosphorylation of STAT3. Subsequently, phosphorylated STAT3 translocates to the nucleus, driving the expression of anti-inflammatory mediators. IL-10 specifically targets antigen-presenting cells (APCs), such as macrophages and monocytes, curbing their release of pro-inflammatory cytokines, including GM-CSF, G-CSF, IL-1 alpha, IL-1 beta, IL-6, IL-8, and TNF-alpha. Additionally, IL-10 interferes with antigen presentation by diminishing the expression of MHC-class II and co-stimulatory molecules, thereby hindering their capacity to induce T cell activation. Moreover, IL-10 maintains control over the inflammatory response of macrophages by reprogramming essential metabolic pathways, including mTOR signaling. Structurally, IL-10 forms a homodimer and engages with IL10RA and IL10RB in its regulatory functions.

Species

Pig

Source

E. coli

Tag

C-His

Accession

Q29055 (S19-N175)

Gene ID
Molecular Construction
N-term
IL-10 (S19-N175)
Accession # Q29055
His
C-term
Synonyms
Interleukin-10; IL10; IL-10; Cytokine synthesis inhibitory factor; CSIF
AA Sequence

MSIKSENSCIHFPTSLPHMLRELRAAFGPVKSFFQTKDQMGDLLLTGSLLEDFKGYLGCQALSEMIQFYLEDVMPKAESDGEDIKEHVNSLGEKLKTLRLRLRRCHQFLPCENKSKAVEEVKSAFSKLQERGVYKAMGEFDIFINYIEAYMTMKMRKN

Molecular Weight

Approximately 19.1 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<0.01 EU per 1 μg of the protein by the LAL method.

Documentation

Animal-Free IL-10 Protein, Pig (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-10 Protein, Pig (His)
Cat. No.:
HY-P700244AF
Quantity:
MCE Japan Authorized Agent: