Animal-Free IL-15 Protein, Human (His)

IL-15 protein regulates immune cells, stimulates the proliferation of NK cells, T cells, and B cells, and promotes cytokine secretion. Animal-Free IL-15 Protein, Human (His) is the recombinant human-derived animal-FreeIL-15 protein, expressed by E. coli , with N-His, N-His labeled tag.

IL-15 Protein assumes a pivotal role in orchestrating inflammatory and protective immune responses against microbial invaders and parasites, modulating immune cells across both the innate and adaptive immune systems. This cytokine stimulates the proliferation of natural killer cells, T-cells, and B-cells, while also promoting the secretion of various cytokines. Notably, IL-15, unlike most cytokines, is expressed on the surface of IL-15-producing cells in association with its high-affinity receptor IL15RA, delivering signals to target cells expressing IL2RB and IL2RG receptor subunits. Upon binding to its receptor, IL-15 triggers the phosphorylation of JAK1 and JAK3, recruiting and subsequently phosphorylating signal transducer and activator of transcription-3/STAT3 and STAT5. In monocytes, IL-15 induces the production of IL8 and monocyte chemotactic protein 1/CCL2, attracting neutrophils and monocytes to infection sites. Additionally, in mast cells, IL-15 induces rapid tyrosine phosphorylation of STAT6, exerting control over mast cell survival and the release of cytokines such as IL4.

1.Measure by its ability to induce MO7e human megakaryocytic leukemic proliferation. The ED₅₀ for this effect is 0.5-3 ng/mL. The specific activity of recombinant human IL15 is approximately 1.5 x 10⁸ IU/mg.
2. Measure by its ability to induce NK cells proliferation. The ED₅₀ for this effect is 5-35 ng/mL.

Human

E. coli

N-His;N-His

P40933-1 (N49-S162)

3600  [NCBI]

NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTSLE

Approximately 13.7 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.