Animal-Free IL-15 Protein, Pig (His)

The IL-15 protein is a key cytokine that promotes inflammatory and protective immune responses against invaders by regulating immune cells in the innate and adaptive systems. It stimulates natural killer cells, T cells and B cells, and promotes the secretion of various cytokines. Animal-Free IL-15 Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-15 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free IL-15 Protein, Pig (His) is 114 a.a., with molecular weight of ~14.1 kDa.

The IL-15 Protein, a pivotal cytokine, assumes a major role in fostering inflammatory and protective immune responses against microbial invaders and parasites by modulating immune cells in both the innate and adaptive immune systems. It effectively stimulates the proliferation of natural killer cells, T-cells, and B-cells, concurrently promoting the secretion of diverse cytokines. In monocytes, IL-15 induces the production of IL8 and monocyte chemotactic protein 1/CCL2, chemokines that attract neutrophils and monocytes to infection sites. Notably, IL-15 differs from most cytokines as it is expressed in association with its high-affinity receptor IL15RA on the surface of IL15-producing cells. This unique expression pattern allows IL-15 to deliver signals to target cells expressing IL2RB and IL2RG receptor subunits. Upon binding to its receptor, IL-15 triggers the phosphorylation of JAK1 and JAK3, recruiting and subsequently phosphorylating signal transducer and activator of transcription-3/STAT3 and STAT5. Furthermore, in mast cells, IL-15 induces the rapid tyrosine phosphorylation of STAT6, exerting control over mast cell survival and the release of cytokines such as IL4.

Pig

E. coli

N-His

Q95253 (T49-S162)

397683  [NCBI]

TWQHVISDLKKIEDLIRSIHMDATLYTESDAHPNCKVTAMKCFLLELRVILQESRNSDISDTVENLIILANSSLSSIEYKTESGCKECEELEEKNINEFLKSFIHIVQMFINPS

Approximately 14.1 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<0.01 EU per 1 μg of the protein by the LAL method.