Animal-Free IL-16 Protein, Mouse (His)

IL-16 is a modulator in inflammatory processes and tumorigenesis. IL16 can bind to the CD4 molecule and activate monocytes and stimulates the secretion of inflammatory cytokines. Besides, IL16 can induce expression of IL2Rα and β, and synergize with IL2 to augment CD4+ T cell activation and proliferation. IL16 can induce migration in CD4+ lymphocytes, monocytes, and eosinophils as a chemoattractant factor^[1][2][3]. Animal-Free IL-16 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-16 protein, expressed by E. coli , with C-His labeled tag.

IL-16, a pleiotropic cytokine, is a modulator in inflammatory processes and tumorigenesis. IL16 can bind to the CD4 molecule and activate monocytes and stimulates the secretion of inflammatory cytokines, such as TNF-α, IL1β, IL6, and IL15^[1]. Besides, IL16 can induce expression of IL2Rα and β, and synergize with IL2 to augment CD4+ T cell activation and proliferation. In addition, IL16 can induce migration in CD4+ lymphocytes, monocytes, and eosinophils as a chemoattractant factor^[2].
IL-16 is constitutively expressed in a variety of cells, such as T cells, B cells, mast cells, eosinophils, and epithelial cells^[2]. IL-16 is mainly produced by CD4+ and CD8+ cells as a precursor protein (pro-IL-16). Pro-IL-16 is enzymatically cleaved by caspase 3, inducing the release of bioactive mature form of IL-16^[3]. Human IL-16 shares about 80% aa sequence identity with mouse.

Mouse

E. coli

C-His

O54824-1 (H1197-S1322)

16170  [NCBI]

MHDLNSSTDSAASASAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGDRTGEMVQPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS

Approximately 14.04 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.