1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-16
  5. Animal-Free IL-16 Protein, Mouse (His)

IL-16 is a modulator in inflammatory processes and tumorigenesis. IL16 can bind to the CD4 molecule and activate monocytes and stimulates the secretion of inflammatory cytokines. Besides, IL16 can induce expression of IL2Rα and β, and synergize with IL2 to augment CD4+ T cell activation and proliferation. IL16 can induce migration in CD4+ lymphocytes, monocytes, and eosinophils as a chemoattractant factor. Animal-Free IL-16 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-16 protein, expressed by E. coli , with C-His labeled tag.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Animal-Free IL-16 Protein, Mouse (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-16 is a modulator in inflammatory processes and tumorigenesis. IL16 can bind to the CD4 molecule and activate monocytes and stimulates the secretion of inflammatory cytokines. Besides, IL16 can induce expression of IL2Rα and β, and synergize with IL2 to augment CD4+ T cell activation and proliferation. IL16 can induce migration in CD4+ lymphocytes, monocytes, and eosinophils as a chemoattractant factor[1][2][3]. Animal-Free IL-16 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-16 protein, expressed by E. coli , with C-His labeled tag.

Background

IL-16, a pleiotropic cytokine, is a modulator in inflammatory processes and tumorigenesis. IL16 can bind to the CD4 molecule and activate monocytes and stimulates the secretion of inflammatory cytokines, such as TNF-α, IL1β, IL6, and IL15[1]. Besides, IL16 can induce expression of IL2Rα and β, and synergize with IL2 to augment CD4+ T cell activation and proliferation. In addition, IL16 can induce migration in CD4+ lymphocytes, monocytes, and eosinophils as a chemoattractant factor[2].
IL-16 is constitutively expressed in a variety of cells, such as T cells, B cells, mast cells, eosinophils, and epithelial cells[2]. IL-16 is mainly produced by CD4+ and CD8+ cells as a precursor protein (pro-IL-16). Pro-IL-16 is enzymatically cleaved by caspase 3, inducing the release of bioactive mature form of IL-16[3]. Human IL-16 shares about 80% aa sequence identity with mouse.

Species

Mouse

Source

E. coli

Tag

C-His

Accession

O54824-1 (H1197-S1322)

Gene ID
Molecular Construction
N-term
IL-16 (H1197-S1322)
Accession # O54824-1
His
C-term
Synonyms
Il16; Pro-interleukin-16Interleukin-16; IL-16; Lymphocyte chemoattractant factor; LCF;
AA Sequence

MHDLNSSTDSAASASAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGDRTGEMVQPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS

Molecular Weight

Approximately 14.04 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IL-16 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-16 Protein, Mouse (His)
Cat. No.:
HY-P72590AF
Quantity:
MCE Japan Authorized Agent: