Animal-Free IL-17F Protein, Human (His)

IL-17F protein is a key effector cytokine in innate and adaptive immunity that maintains tissue integrity and protects against microorganisms. It acts through the IL17RA-IL17RC receptor complex, activates the NF-kappa-B and MAPkinase pathways, and induces the transcription of immune-related genes. Animal-Free IL-17F Protein, Human (His) is the recombinant human-derived animal-FreeIL-17F protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-17F Protein, Human (His) is 133 a.a., with molecular weight of ~15.84 kDa.

IL-17F Protein serves as a key effector cytokine in the innate and adaptive immune systems, crucial for antimicrobial defense and tissue integrity maintenance. Operating through the IL17RA-IL17RC receptor complex, it triggers downstream activation of NF-kappa-B and MAPkinase pathways, leading to the transcriptional activation of various immune-related genes. Primarily associated with Th17 cells, IL-17F induces neutrophil activation, antimicrobial peptide production, and regulates immune tolerance. It forms homodimers and heterodimers with IL-17A, influencing diverse biological processes, from sympathetic innervation to microbiota regulation. The complex interactions and signaling pathways orchestrated by IL-17F underscore its multifaceted role in immune responses and cellular homeostasis.

Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED₅₀ for this effect is <20 ng/mL.

Human

E. coli

C-His

Q96PD4 (R31-Q163)

112744  [NCBI]

MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ

Approximately 15.84 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 20 mM sodium acetate, pH 4.0, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.