Animal-Free IL-19 Protein, Human (His)

Animal-Free IL-19 Protein, Human (His) is the recombinant human-derived animal-FreeIL-19 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-19 Protein, Human (His) is 154 a.a., with molecular weight of ~18.69 kDa.

Measure by its ability to induce proliferation in BaF3 cells transfected with human IL-20 R alpha and human IL-20 R beta. The ED₅₀ for this effect is <1.2 ng/mL

Human

E. coli

C-His

AAK91776.1 (L63-A215)

29949  [NCBI]

MLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA

Approximately 18.69 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.