Animal-Free IL-19 Protein, Mouse (His)

The IL-19 protein functions as a multifaceted cytokine, acting as both an anti-inflammatory and a pro-angiogenic factor. It plays a key role in polarizing adaptive immunity toward an anti-inflammatory phenotype by inducing T helper 2 responses. Animal-Free IL-19 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-19 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-19 Protein, Mouse (His) is 152 a.a., with molecular weight of ~18.54 kDa.

The IL-19 Protein operates as a multifaceted cytokine, acting as both an anti-inflammatory and proangiogenic factor. It plays a pivotal role in polarizing adaptive immunity towards an anti-inflammatory phenotype by inducing T-helper 2 responses. This involves a dual mechanism of down-regulating IFN-gamma and up-regulating IL4 and IL5. Notably produced by osteocytes, IL-19 further stimulates granulopoiesis and the formation of neutrophils. Its biological effects are mediated through a receptor complex composed of the IL20RA and IL20RB heterodimer. Upon binding, IL-19 activates the Janus kinase (JAK) and signal transducer and activator of transcription (STAT) pathway, with particular emphasis on STAT3, contributing to its diverse immunomodulatory functions.

Measure by its ability to induce proliferation in BaF3 cells transfected with human IL-20 R alpha and human IL-20 R beta. The ED₅₀ for this effect is <0.6 ng/mL.

Mouse

E. coli

C-His

Q8CJ70 (L25-A176)

329244  [NCBI]

MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA

Approximately 18.54 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.