Animal-Free IL-1RA/IL-1RN Protein, Mouse (His)

IL-1RN protein serves as an anti-inflammatory antagonist, targeting proinflammatory cytokines IL1B and IL1A within the interleukin-1 family. Playing a protective role, it prevents immune dysregulation and systemic inflammation induced by IL1, particularly in response to innate stimulatory agents. IL-1RN's regulatory activity contributes to a balanced immune response, safeguarding the host from the detrimental effects of excessive inflammation. Animal-Free IL-1RA/IL-1RN Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1RA/IL-1RN protein, expressed by E. coli , with C-His labeled tag.

The IL-1RN protein functions as an anti-inflammatory antagonist within the interleukin-1 family, specifically targeting proinflammatory cytokines like interleukin-1beta/IL1B and interleukin-1alpha/IL1A. Acting as a protective barrier, this protein plays a crucial role in preventing immune dysregulation and uncontrolled systemic inflammation induced by IL1, particularly in response to various innate stimulatory agents such as pathogens. Its regulatory activity contributes to maintaining a balanced immune response and safeguarding the host from the detrimental effects of excessive inflammation.

Measure by its ability to inhibit IL-1 alpha -dependent proliferation in D10.G4.1 cells. The ED₅₀ for this effect is <50 ng/mL.

Mouse

E. coli

C-His

P25085-1 (R27-Q178)

16181  [NCBI]

MRPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ

Approximately 18.27 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.