1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-17
  5. IL-25/IL-17E
  6. Animal-Free IL-25/IL-17E Protein, Mouse (His)

Animal-Free IL-25/IL-17E Protein, Mouse (His)

Cat. No.: HY-P700201AF
Handling Instructions Technical Support

Interleukin-25 (IL-25), also known as IL-17E, belongs to the IL-17 cytokine family. IL-25 activates NF-κB, MAPKs and JAK/STAT signaling pathways. IL-25 exerts singal transduction through receptors composed of IL17RA and IL17RB. Animal-Free IL-25/IL-17E Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-25/IL-17E protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-25/IL-17E Protein, Mouse (His) is 153 a.a., with molecular weight of ~18.41 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Interleukin-25 (IL-25), also known as IL-17E, belongs to the IL-17 cytokine family. IL-25 activates NF-κB, MAPKs and JAK/STAT signaling pathways[1]. IL-25 exerts singal transduction through receptors composed of IL17RA and IL17RB[7]. Animal-Free IL-25/IL-17E Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-25/IL-17E protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-25/IL-17E Protein, Mouse (His) is 153 a.a., with molecular weight of ~18.41 kDa.

Background

and is also produced by various immune cells such as CD8+ T cells, mast cells, macrophages, dendritic cells (DCs), eosinophils, basophils, group 2 innate lymphoid cells (ILC2s), epithelial and endothelial cells[1][2][3][4][5][6]. IL-25 exerts singal transduction through receptors composed of IL17RA and IL17RB[7]. IL-25 induces the expression of IL-4, IL-5, IL-13, TGF-β, and G-CSF[8][9]. IL-25 can stimulate cell proliferation, inhibition of apoptosis, production of inflammatory cytokines and chemokines, modulation of cell-cell adhesion, and cell motility in nonimmune cells[10][11][12][13]. IL-25 activates NF-κB, MAPKs and JAK/STATs signaling pathways[1][14]. The sequence homology of IL-25 between human and mouse, mouse and rat is 78.88% and 91.12% respectively.

Biological Activity

Measured by its ability to induce CXCL1 secretion in HT- 29 cells. The ED50 for this effect is ≤1 ng/mL.

Species

Mouse

Source

E. coli

Tag

C-His

Accession

Q8VHH8 (V17-A169)

Gene ID
Molecular Construction
N-term
IL-17E (V17-A169)
Accession # Q8VHH8
His
C-term
Synonyms
Interleukin-25; IL-25; Interleukin-17E; IL-17E
AA Sequence

MVSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA

Molecular Weight

Approximately 18.41 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-25/IL-17E Protein, Mouse (His)
Cat. No.:
HY-P700201AF
Quantity:
MCE Japan Authorized Agent: