Animal-Free IL-36 alpha/IL-1F6 Protein, Human (His)

IL-36 α/IL-1F6 protein binds to IL1RL2/IL-36R receptor, activates NF-kappa-B and MAPK pathways, and induces pro-inflammatory responses. IL-36 α/IL-1F6 also upregulates CD83, CD86, and HLA-DR in dendritic cells, promotes dendritic cell maturation, and drives T cell proliferation. Animal-Free IL-36 alpha/IL-1F6 Protein, Human (His) is the recombinant human-derived animal-FreeIL-36 alpha/IL-1F6 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-36 alpha/IL-1F6 Protein, Human (His) is 153 a.a., with molecular weight of ~18.05 kDa.

IL-36 alpha/IL-1F6 protein, a cytokine, binds to and signals through the IL1RL2/IL-36R receptor, activating the NF-kappa-B and MAPK signaling pathways in target cells, thereby contributing to a pro-inflammatory response. As part of the IL-36 signaling system, it is believed to be present in epithelial barriers and involved in local inflammatory responses, sharing similarities with the IL-1 system through the coreceptor IL1RAP. IL-36 alpha/IL-1F6 appears to play a crucial role in skin inflammatory responses by influencing keratinocytes, dendritic cells, and indirectly impacting T-cells, promoting tissue infiltration, cell maturation, and cell proliferation. In cultured keratinocytes, it induces the expression of various chemokines and pro-inflammatory cytokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20, CXCL1, TNF-alpha, IL-8, and IL-6. Additionally, IL-36 alpha/IL-1F6 up-regulates the expression of IL-1A, IL-1B, and IL-6 in cultured monocytes, promotes cell maturation in myeloid dendritic cells, and facilitates dendritic cell maturation while driving T-cell proliferation in monocyte-derived dendritic cells. Its interaction with TMED10 mediates translocation from the cytoplasm into the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) and subsequent secretion. Furthermore, IL-36 alpha/IL-1F6 may contribute to pro-inflammatory effects in the lung.

Measure by its ability to induce IL-8 secretion in human PBMCs. The ED₅₀ for this effect is <0.7 ng/mL.

Human

E. coli

C-His

Q9UHA7 (K6-F158)

27179  [NCBI]

MKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF

Approximately 18.05 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.