Animal-Free IL-36 gamma/IL-1F9 Protein, Human (His)

IL-36 gamma/IL-1F9 protein activates the NF-kappa-B and MAPK pathways, induces the expression of various chemokines and pro-inflammatory factors, and promotes local inflammatory responses in the epithelial barrier. It affects keratinocytes, dendritic cells, and T cells, driving tissue infiltration, maturation, and proliferation. Animal-Free IL-36 gamma/IL-1F9 Protein, Human (His) is the recombinant human-derived animal-FreeIL-36 gamma/IL-1F9 protein, expressed by E. coli , with C-His, C-His labeled tag.

IL-36 gamma/IL-1F9 protein, a cytokine, binds to and signals through the IL1RL2/IL-36R receptor, activating NF-kappa-B and MAPK signaling pathways in target cells, thereby contributing to a pro-inflammatory response. As a vital component of the IL-36 signaling system believed to be present in epithelial barriers, IL-36 gamma shares similarities with the IL-1 system and utilizes the coreceptor IL1RAP. It appears to be integral to skin inflammatory responses, exerting influence on keratinocytes, dendritic cells, and indirectly impacting T-cells, thereby driving tissue infiltration, cell maturation, and proliferation. In cultured keratinocytes, IL-36 gamma induces the expression of various chemokines, including CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20, and CXCL1. Additionally, IL-36 gamma stimulates its own expression and that of prototypic cutaneous pro-inflammatory parameters such as TNF-alpha, S100A7/psoriasin, and inducible NOS. It may play a role in pro-inflammatory responses during specific neutrophilic airway inflammation, activating mitogen-activated protein kinases and NF-kappa B in primary lung fibroblasts and stimulating the expression of IL-8, CXCL3, and Th17 chemokine CCL20 in lung fibroblasts. IL-36 gamma might also be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus. Interacting with the cargo receptor TMED10, IL-36 gamma undergoes translocation from the cytoplasm into the endoplasmic reticulum-Golgi intermediate compartment (ERGIC), facilitating secretion.

Measure by its ability to induce IL-8 secretion in A431 cells. The ED₅₀ for this effect is <5 ng/mL.

Human

E. coli

C-His;C-His

Q9NZH8-1 (S18-D169)

56300  [NCBI]

MSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND

Approximately 17.98 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.