1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors Neurotrophic Factors
  4. IL-6
  5. Animal-Free IL-6 Protein, Human (His)

IL-6 protein is a multifunctional cytokine that plays multiple biological functions in immunity, tissue regeneration, and metabolism. After binding to IL6R, the resulting complex binds to the signaling subunit IL6ST/gp130, triggering the intracellular IL6 signaling pathway. Animal-Free IL-6 Protein, Human (His) is the recombinant human-derived animal-FreeIL-6 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-6 Protein, Human (His) is 184 a.a., with molecular weight of ~21.8 kDa.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-6 protein is a multifunctional cytokine that plays multiple biological functions in immunity, tissue regeneration, and metabolism. After binding to IL6R, the resulting complex binds to the signaling subunit IL6ST/gp130, triggering the intracellular IL6 signaling pathway. Animal-Free IL-6 Protein, Human (His) is the recombinant human-derived animal-FreeIL-6 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-6 Protein, Human (His) is 184 a.a., with molecular weight of ~21.8 kDa.This product is for cell culture use only.

Background

GMP IL-6 Protein, a versatile cytokine, performs various biological functions in immunity, tissue regeneration, and metabolism. Upon binding to IL6R, the resulting complex associates with the signaling subunit IL6ST/gp130, triggering the intracellular IL6-signaling pathway. Its interaction with membrane-bound IL6R and IL6ST stimulates 'classic signaling,' while the binding of IL6 and soluble IL6R to IL6ST induces 'trans-signaling.' Moreover, 'cluster signaling' occurs when membrane-bound IL6:IL6R complexes on transmitter cells activate IL6ST receptors on neighboring receiver cells. IL-6 serves as a potent inducer of the acute phase response, rapidly mobilizing host defenses during infection and tissue injury, although excessive IL6 synthesis is implicated in disease pathology. In the innate immune response, IL-6 is synthesized by myeloid cells, such as macrophages and dendritic cells, upon recognizing pathogens through toll-like receptors at the infection or tissue injury site. In the adaptive immune response, IL-6 is essential for B-cell differentiation into immunoglobulin-secreting cells and plays a major role in the differentiation of CD4(+) T cell subsets. It is a crucial factor in the development of T follicular helper (Tfh) cells necessary for germinal-center formation and is required to drive naive CD4(+) T cells to the Th17 lineage. Additionally, IL-6 is essential for the proliferation of myeloma cells and the survival of plasmablast cells.

Biological Activity

1.Measure by its ability to induce proliferation in TF-1 cells The ED50 for this effect is <0.5 ng/mL. The specific activity of recombinant human IL-6 is approximately >5 x 108 IU/mg.
2.Measure by its ability to induce proliferation in MCF-7 cells. The ED50 for this effect is <4.4 ng/mL.

Species

Human

Source

E. coli

Tag

C-His

Accession

P05231 (P29-M212)

Gene ID
Molecular Construction
N-term
IL-6 (P29-M212)
Accession # P05231
His
C-term
Synonyms
Interleukin-6; IL-6; B-Cell Stimulatory Factor 2; BSF-2; CTL Differentiation Factor; CDF; Hybridoma Growth Factor; Interferon Beta-2; IFN-Beta-2; IL6; IFNB2
AA Sequence

MVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Molecular Weight

Approximately 21.8 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose or PBS, pH 8.0.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-6 Protein, Human (His)
Cat. No.:
HY-P7044AF
Quantity:
MCE Japan Authorized Agent: