1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors Neurotrophic Factors
  4. IL-6
  5. Animal-Free IL-6 Protein, Pig (His)

IL-6 protein is a multifunctional cytokine that participates in immune, regenerative and metabolic processes by binding to IL6R and forming a complex with IL6ST/gp130. This activates the IL6 signaling pathway, initiating "classical signaling" via membrane-bound IL6R and IL6ST, "trans signaling" via binding of IL6 and soluble IL6R to IL6ST, and "cluster signaling" via the IL6:IL6R complex ". Animal-Free IL-6 Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-6 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-6 Protein, Pig (His) is 182 a.a., with molecular weight of ~21.9 kDa.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-6 protein is a multifunctional cytokine that participates in immune, regenerative and metabolic processes by binding to IL6R and forming a complex with IL6ST/gp130. This activates the IL6 signaling pathway, initiating "classical signaling" via membrane-bound IL6R and IL6ST, "trans signaling" via binding of IL6 and soluble IL6R to IL6ST, and "cluster signaling" via the IL6:IL6R complex ". Animal-Free IL-6 Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-6 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-6 Protein, Pig (His) is 182 a.a., with molecular weight of ~21.9 kDa.This product is for cell culture use only.

Background

IL-6 Protein is a versatile cytokine involved in various immune, regenerative, and metabolic processes. It exerts its effects by binding to IL6R, leading to the formation of a complex with the signaling subunit IL6ST/gp130, which activates the intracellular IL6-signaling pathway. This interaction can trigger different types of signaling, including 'classic signaling' through the membrane-bound IL6R and IL6ST, 'trans-signaling' through the binding of IL6 and soluble IL6R to IL6ST, and 'cluster signaling' through IL6:IL6R complexes on transmitter cells activating IL6ST receptors on neighboring receiver cells. IL-6 is crucial for the acute phase response, playing a role in host defense during infection and tissue injury. However, excessive IL-6 production is implicated in disease pathology. It is synthesized by myeloid cells like macrophages and dendritic cells in response to pathogen recognition through toll-like receptors (TLRs). In the adaptive immune response, IL-6 is necessary for B cell differentiation into immunoglobulin-secreting cells and plays a significant role in the differentiation of CD4(+) T cell subsets. It is an essential factor for the development of T follicular helper (Tfh) cells, which are crucial for germinal-center formation, and for the induction of the Th17 lineage in naive CD4(+) T cells. Additionally, IL-6 is required for the proliferation and survival of myeloma cells and plasmablast cells.

Species

Pig

Source

E. coli

Tag

C-His

Accession

P26893 (R31-M212)

Gene ID
Molecular Construction
N-term
IL-6 (R31-M212)
Accession # P26893
His
C-term
Synonyms
Interleukin-6; Interleukin HP-1; BSF2; HSF; IFNB2
AA Sequence

MGRLEEDAKGDATSDKMLFTSPDKTEELIKYILGKISAMRKEMCEKYEKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLVEFQIYLDYLQKEYESNKGNVEAVQISTKALIQTLRQKGKNPDKATTPNPTTNAGLLDKLQSQNEWMKNTKIILILRSLEDFLQFSLRAIRIM

Molecular Weight

Approximately 21.9 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-6 Protein, Pig (His)
Cat. No.:
HY-P700249AF
Quantity:
MCE Japan Authorized Agent: